DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lac and Cd274

DIOPT Version :9

Sequence 1:NP_523713.2 Gene:Lac / 36363 FlyBaseID:FBgn0010238 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001178883.1 Gene:Cd274 / 499342 RGDID:1566211 Length:290 Species:Rattus norvegicus


Alignment Length:185 Identity:44/185 - (23%)
Similarity:65/185 - (35%) Gaps:55/185 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 VASEGSEVQMECYASGYPTP--------TITWRREN----------------------NAILPTD 180
            |...||.|.|||   .:|..        .:.|.:|:                      .|.||.|
  Rat    29 VVEYGSNVTMEC---RFPVEQKLDLLALVVYWEKEDKEVIQFVEGEEDLKPQHSSFRGRAFLPKD 90

  Fly   181 SATYVGNTLRIKSVKKEDRGTYYCVADNGVSKGDRRNINVEVEFAPVITVPRPRLGQALQYD--- 242
            ........|:|..||.:|.|.|.|:...|  ..|.:.|.::|      ..|..::.|.:..|   
  Rat    91 QLLKGNAVLQITDVKLQDAGVYCCMISYG--GADYKRITLKV
------NAPYRKINQRISMDPAT 147

  Fly   243 --MDLECHIEAYPPPAIVWTKDDIQLANNQHYSIS--HFATADEYTDSTLRVITV 293
              .:|.|..|.||...::||       |:.|.|:|  ...|..:..:..|.|.:|
  Rat   148 SEHELMCQAEGYPEAEVIWT-------NSDHQSLSGETTVTTSQTEEKLLNVTSV 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LacNP_523713.2 IG_like 36..131 CDD:214653
FR1 37..50 CDD:409353
Ig strand A' 37..42 CDD:409353
Ig strand B 44..51 CDD:409353
CDR1 51..59 CDD:409353
Ig strand C 59..63 CDD:409353
FR2 60..63 CDD:409353
CDR2 67..81 CDD:409353
Ig strand C' 68..72 CDD:409353
Ig strand C' 79..81 CDD:409353
FR3 84..115 CDD:409353
Ig strand D 84..90 CDD:409353
Ig strand E 94..102 CDD:409353
Ig strand F 108..115 CDD:409353
CDR3 116..124 CDD:409353
FR4 124..130 CDD:409353
Ig strand G 124..130 CDD:409353
Ig_3 134..208 CDD:404760 22/91 (24%)
Ig strand B 153..157 CDD:409353 2/3 (67%)
Ig strand C 166..170 CDD:409353 0/3 (0%)
Ig strand E 187..191 CDD:409353 1/3 (33%)
Ig strand F 201..206 CDD:409353 2/4 (50%)
Ig strand G 215..218 CDD:409353 0/2 (0%)
Ig 227..318 CDD:416386 18/74 (24%)
Ig strand C 256..260 CDD:409353 0/3 (0%)
Ig strand E 286..290 CDD:409353 1/3 (33%)
Ig strand F 300..305 CDD:409353
Cd274NP_001178883.1 Ig 21..130 CDD:416386 25/105 (24%)
FR1 21..41 CDD:409353 7/14 (50%)
Ig strand A 21..24 CDD:409353
Ig strand A' 26..31 CDD:409353 1/1 (100%)
Ig strand B 33..41 CDD:409353 6/10 (60%)
CDR1 42..53 CDD:409353 1/10 (10%)
Ig strand C 53..59 CDD:409353 1/5 (20%)
FR2 54..62 CDD:409353 2/7 (29%)
CDR2 63..74 CDD:409353 0/10 (0%)
Ig strand C' 63..68 CDD:409353 0/4 (0%)
Ig strand C' 70..74 CDD:409353 0/3 (0%)
FR3 75..116 CDD:409353 12/40 (30%)
Ig strand D 84..88 CDD:409353 1/3 (33%)
Ig strand E 96..103 CDD:409353 2/6 (33%)
Ig strand F 107..117 CDD:409353 4/9 (44%)
CDR3 117..121 CDD:409353 1/5 (20%)
Ig strand G 121..130 CDD:409353 2/8 (25%)
FR4 122..130 CDD:409353 2/7 (29%)
Ig 138..217 CDD:416386 17/65 (26%)
Ig strand A 138..143 CDD:409353 1/4 (25%)
Ig strand B 150..157 CDD:409353 2/6 (33%)
Ig strand C 162..167 CDD:409353 0/4 (0%)
Ig strand C' 168..175 CDD:409353 3/6 (50%)
Ig strand D 179..185 CDD:409353 1/5 (20%)
Ig strand E 189..198 CDD:409353 3/7 (43%)
Ig strand F 205..213 CDD:409353
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.