Sequence 1: | NP_523713.2 | Gene: | Lac / 36363 | FlyBaseID: | FBgn0010238 | Length: | 359 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001229536.1 | Gene: | NCAM1 / 4684 | HGNCID: | 7656 | Length: | 884 | Species: | Homo sapiens |
Alignment Length: | 345 | Identity: | 83/345 - (24%) |
---|---|---|---|
Similarity: | 148/345 - (42%) | Gaps: | 68/345 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 12 STLLLAIFVQQTLAQRTPTISYITQEQIKDIGGTVEFDCSVQYAKEYNVLFLKTDSDPVFLSTGS 76
Fly 77 TLVIKDSRFSLRYDPNSSTYKLQIKDIQETDAGTYTCQVVISTVHKVS-AEVKLSVRRPPVISDN 140
Fly 141 STQSVV---ASEGSEVQMECYASGYPTPTITWRRENNAI-LPTDSATYV----GNTLRIKSVKKE 197
Fly 198 DRGTYYCVADNGVSKGDRRNINVEVEFAPVITVPRPRLGQALQYDMDLECHIEAYPPPAIVWTKD 262
Fly 263 DIQLANNQHYSISH-------------------------FATADEYTDSTLRV--------ITVE 294
Fly 295 KRQY---GDYVCKATNRFGE 311 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Lac | NP_523713.2 | IG_like | 36..131 | CDD:214653 | 21/95 (22%) |
FR1 | 37..50 | CDD:409353 | 1/12 (8%) | ||
Ig strand A' | 37..42 | CDD:409353 | 0/4 (0%) | ||
Ig strand B | 44..51 | CDD:409353 | 0/6 (0%) | ||
CDR1 | 51..59 | CDD:409353 | 1/7 (14%) | ||
Ig strand C | 59..63 | CDD:409353 | 0/3 (0%) | ||
FR2 | 60..63 | CDD:409353 | 0/2 (0%) | ||
CDR2 | 67..81 | CDD:409353 | 1/13 (8%) | ||
Ig strand C' | 68..72 | CDD:409353 | 1/3 (33%) | ||
Ig strand C' | 79..81 | CDD:409353 | 0/1 (0%) | ||
FR3 | 84..115 | CDD:409353 | 14/30 (47%) | ||
Ig strand D | 84..90 | CDD:409353 | 2/5 (40%) | ||
Ig strand E | 94..102 | CDD:409353 | 4/7 (57%) | ||
Ig strand F | 108..115 | CDD:409353 | 4/6 (67%) | ||
CDR3 | 116..124 | CDD:409353 | 1/7 (14%) | ||
FR4 | 124..130 | CDD:409353 | 0/6 (0%) | ||
Ig strand G | 124..130 | CDD:409353 | 0/6 (0%) | ||
Ig_3 | 134..208 | CDD:404760 | 27/81 (33%) | ||
Ig strand B | 153..157 | CDD:409353 | 1/3 (33%) | ||
Ig strand C | 166..170 | CDD:409353 | 1/3 (33%) | ||
Ig strand E | 187..191 | CDD:409353 | 1/3 (33%) | ||
Ig strand F | 201..206 | CDD:409353 | 2/4 (50%) | ||
Ig strand G | 215..218 | CDD:409353 | 0/2 (0%) | ||
Ig | 227..318 | CDD:416386 | 23/121 (19%) | ||
Ig strand C | 256..260 | CDD:409353 | 1/3 (33%) | ||
Ig strand E | 286..290 | CDD:409353 | 0/3 (0%) | ||
Ig strand F | 300..305 | CDD:409353 | 2/4 (50%) | ||
NCAM1 | NP_001229536.1 | Ig1_NCAM-1 | 20..115 | CDD:143273 | 1/6 (17%) |
IG | 124..190 | CDD:214652 | 21/84 (25%) | ||
Ig | 211..307 | CDD:325142 | 31/98 (32%) | ||
Ig | 306..438 | CDD:325142 | 24/124 (19%) | ||
Ig_3 | 447..519 | CDD:316449 | |||
FN3 | 534..631 | CDD:238020 | |||
fn3 | 639..720 | CDD:306538 | |||
Trypan_PARP | <792..>864 | CDD:330686 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR12231 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.910 |