| Sequence 1: | NP_523713.2 | Gene: | Lac / 36363 | FlyBaseID: | FBgn0010238 | Length: | 359 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_002474.4 | Gene: | CEACAM6 / 4680 | HGNCID: | 1818 | Length: | 344 | Species: | Homo sapiens |
| Alignment Length: | 275 | Identity: | 68/275 - (24%) |
|---|---|---|---|
| Similarity: | 105/275 - (38%) | Gaps: | 50/275 - (18%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 91 PNSSTYKLQIKDIQETDAGTYTCQVVISTVHKVSA----EVKLSVRRPPVISDNSTQSVVASEGS 151
Fly 152 EVQMECYASGYPTPTITWRRENNAILPTDSATYVGN---TLRIKSVKKEDRGTYYCVADNGVSKG 213
Fly 214 DRRNINVEVEFAPVITVPRP-----RLGQALQYDMDLECHIEAYPPPAIVWTKDDIQLANNQHYS 273
Fly 274 ISHFATADEYTDSTLRVITVEKRQYGDYVCKATNRFGEAEARVNLFETIIPVCPPACGQAYIAGA 338
Fly 339 EDVSATSFALVGILA 353 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Lac | NP_523713.2 | IG_like | 36..131 | CDD:214653 | 14/43 (33%) |
| FR1 | 37..50 | CDD:409353 | |||
| Ig strand A' | 37..42 | CDD:409353 | |||
| Ig strand B | 44..51 | CDD:409353 | |||
| CDR1 | 51..59 | CDD:409353 | |||
| Ig strand C | 59..63 | CDD:409353 | |||
| FR2 | 60..63 | CDD:409353 | |||
| CDR2 | 67..81 | CDD:409353 | |||
| Ig strand C' | 68..72 | CDD:409353 | |||
| Ig strand C' | 79..81 | CDD:409353 | |||
| FR3 | 84..115 | CDD:409353 | 9/23 (39%) | ||
| Ig strand D | 84..90 | CDD:409353 | |||
| Ig strand E | 94..102 | CDD:409353 | 3/7 (43%) | ||
| Ig strand F | 108..115 | CDD:409353 | 3/6 (50%) | ||
| CDR3 | 116..124 | CDD:409353 | 1/7 (14%) | ||
| FR4 | 124..130 | CDD:409353 | 2/9 (22%) | ||
| Ig strand G | 124..130 | CDD:409353 | 2/9 (22%) | ||
| Ig_3 | 134..208 | CDD:404760 | 21/76 (28%) | ||
| Ig strand B | 153..157 | CDD:409353 | 1/3 (33%) | ||
| Ig strand C | 166..170 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 187..191 | CDD:409353 | 3/6 (50%) | ||
| Ig strand F | 201..206 | CDD:409353 | 2/4 (50%) | ||
| Ig strand G | 215..218 | CDD:409353 | 0/2 (0%) | ||
| Ig | 227..318 | CDD:416386 | 19/95 (20%) | ||
| Ig strand C | 256..260 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 286..290 | CDD:409353 | 0/3 (0%) | ||
| Ig strand F | 300..305 | CDD:409353 | 2/4 (50%) | ||
| CEACAM6 | NP_002474.4 | IgV_CEACAM_D1 | 36..140 | CDD:409430 | 13/39 (33%) |
| Ig strand B | 51..55 | CDD:409430 | |||
| Ig strand C | 64..68 | CDD:409430 | |||
| Ig strand E | 105..109 | CDD:409430 | 2/6 (33%) | ||
| Ig strand F | 119..124 | CDD:409430 | 2/4 (50%) | ||
| Ig strand G | 133..136 | CDD:409430 | 1/2 (50%) | ||
| IgI_hCEACAM_2_4_6_like | 146..234 | CDD:409402 | 23/92 (25%) | ||
| Ig strand B | 163..167 | CDD:409402 | 1/3 (33%) | ||
| Ig strand C | 176..180 | CDD:409402 | 1/5 (20%) | ||
| Ig strand E | 198..202 | CDD:409402 | 2/3 (67%) | ||
| Ig strand F | 212..217 | CDD:409402 | 2/4 (50%) | ||
| Ig strand G | 227..230 | CDD:409402 | 0/2 (0%) | ||
| IgC2_CEACAM5-like | 243..318 | CDD:409540 | 21/101 (21%) | ||
| Ig strand B | 255..259 | CDD:409540 | 1/3 (33%) | ||
| Ig strand C | 268..272 | CDD:409540 | 0/3 (0%) | ||
| Ig strand E | 285..289 | CDD:409540 | 1/17 (6%) | ||
| Ig strand F | 296..301 | CDD:409540 | 2/4 (50%) | ||
| Ig strand G | 311..314 | CDD:409540 | 1/2 (50%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||