Sequence 1: | NP_523713.2 | Gene: | Lac / 36363 | FlyBaseID: | FBgn0010238 | Length: | 359 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_002474.4 | Gene: | CEACAM6 / 4680 | HGNCID: | 1818 | Length: | 344 | Species: | Homo sapiens |
Alignment Length: | 275 | Identity: | 68/275 - (24%) |
---|---|---|---|
Similarity: | 105/275 - (38%) | Gaps: | 50/275 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 91 PNSSTYKLQIKDIQETDAGTYTCQVVISTVHKVSA----EVKLSVRRPPVISDNSTQSVVASEGS 151
Fly 152 EVQMECYASGYPTPTITWRRENNAILPTDSATYVGN---TLRIKSVKKEDRGTYYCVADNGVSKG 213
Fly 214 DRRNINVEVEFAPVITVPRP-----RLGQALQYDMDLECHIEAYPPPAIVWTKDDIQLANNQHYS 273
Fly 274 ISHFATADEYTDSTLRVITVEKRQYGDYVCKATNRFGEAEARVNLFETIIPVCPPACGQAYIAGA 338
Fly 339 EDVSATSFALVGILA 353 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Lac | NP_523713.2 | IG_like | 36..131 | CDD:214653 | 14/43 (33%) |
FR1 | 37..50 | CDD:409353 | |||
Ig strand A' | 37..42 | CDD:409353 | |||
Ig strand B | 44..51 | CDD:409353 | |||
CDR1 | 51..59 | CDD:409353 | |||
Ig strand C | 59..63 | CDD:409353 | |||
FR2 | 60..63 | CDD:409353 | |||
CDR2 | 67..81 | CDD:409353 | |||
Ig strand C' | 68..72 | CDD:409353 | |||
Ig strand C' | 79..81 | CDD:409353 | |||
FR3 | 84..115 | CDD:409353 | 9/23 (39%) | ||
Ig strand D | 84..90 | CDD:409353 | |||
Ig strand E | 94..102 | CDD:409353 | 3/7 (43%) | ||
Ig strand F | 108..115 | CDD:409353 | 3/6 (50%) | ||
CDR3 | 116..124 | CDD:409353 | 1/7 (14%) | ||
FR4 | 124..130 | CDD:409353 | 2/9 (22%) | ||
Ig strand G | 124..130 | CDD:409353 | 2/9 (22%) | ||
Ig_3 | 134..208 | CDD:404760 | 21/76 (28%) | ||
Ig strand B | 153..157 | CDD:409353 | 1/3 (33%) | ||
Ig strand C | 166..170 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 187..191 | CDD:409353 | 3/6 (50%) | ||
Ig strand F | 201..206 | CDD:409353 | 2/4 (50%) | ||
Ig strand G | 215..218 | CDD:409353 | 0/2 (0%) | ||
Ig | 227..318 | CDD:416386 | 19/95 (20%) | ||
Ig strand C | 256..260 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 286..290 | CDD:409353 | 0/3 (0%) | ||
Ig strand F | 300..305 | CDD:409353 | 2/4 (50%) | ||
CEACAM6 | NP_002474.4 | IgV_CEACAM_D1 | 36..140 | CDD:409430 | 13/39 (33%) |
Ig strand B | 51..55 | CDD:409430 | |||
Ig strand C | 64..68 | CDD:409430 | |||
Ig strand E | 105..109 | CDD:409430 | 2/6 (33%) | ||
Ig strand F | 119..124 | CDD:409430 | 2/4 (50%) | ||
Ig strand G | 133..136 | CDD:409430 | 1/2 (50%) | ||
IgI_hCEACAM_2_4_6_like | 146..234 | CDD:409402 | 23/92 (25%) | ||
Ig strand B | 163..167 | CDD:409402 | 1/3 (33%) | ||
Ig strand C | 176..180 | CDD:409402 | 1/5 (20%) | ||
Ig strand E | 198..202 | CDD:409402 | 2/3 (67%) | ||
Ig strand F | 212..217 | CDD:409402 | 2/4 (50%) | ||
Ig strand G | 227..230 | CDD:409402 | 0/2 (0%) | ||
IgC2_CEACAM5-like | 243..318 | CDD:409540 | 21/101 (21%) | ||
Ig strand B | 255..259 | CDD:409540 | 1/3 (33%) | ||
Ig strand C | 268..272 | CDD:409540 | 0/3 (0%) | ||
Ig strand E | 285..289 | CDD:409540 | 1/17 (6%) | ||
Ig strand F | 296..301 | CDD:409540 | 2/4 (50%) | ||
Ig strand G | 311..314 | CDD:409540 | 1/2 (50%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |