DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lac and opcml

DIOPT Version :10

Sequence 1:NP_523713.2 Gene:Lac / 36363 FlyBaseID:FBgn0010238 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001005580.1 Gene:opcml / 449538 ZFINID:ZDB-GENE-040927-3 Length:342 Species:Danio rerio


Alignment Length:320 Identity:80/320 - (25%)
Similarity:124/320 - (38%) Gaps:55/320 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 SYITQEQIKDIGGTVEFDCS-------VQYAKEYNVLFL---KTDSDP--VFLSTGSTLVIKDSR 84
            ||:........|.:....||       |.:.....:||.   |...||  |.|:|.         
Zfish    36 SYLKDNITVRQGDSAVLKCSMDNKVSRVAWLNRTTILFTGNEKWSLDPRVVLLNTA--------- 91

  Fly    85 FSLRYDPNSSTYKLQIKDIQETDAGTYTCQVVISTVHKVSAEVKLSVRRPPVISDNSTQSVVASE 149
                    .:.|.::|.::...|.|.|.|. :::.....|.:|.|.|:.|..|.:.|| .|..:|
Zfish    92 --------VNEYSIKILNVNLYDEGPYVCS-ILTNKKPESTKVHLIVQVPARIVNVST-DVSVNE 146

  Fly   150 GSEVQMECYASGYPTPTITWR---RENNAILPTDSATYVGNTLRIKSVKKEDRGTYYCVADNGVS 211
            ||.|.:.|.|.|.|.|:|.|:   .:.|.|:..      |..:.:..:.|:..|:|.|:..|.:|
Zfish   147 GSNVSLMCLAIGRPEPSILWKFRSSKGNRIVTE------GEYVEMTGITKDMSGSYDCITSNDIS 205

  Fly   212 KGDRRNINVEVEFAPVITVPRPRLGQALQYDMDLECHIEAYPPPAIVWTKDDIQLANNQHYSISH 276
            ..|.|.:.|.|.:.|||:..| ..|.|:.....|.|...|.|.....|.|.:.::.|    ..:.
Zfish   206 PPDVRTVQVTVNYPPVISRAR-STGTAVGQKGVLWCEASAVPLADFQWFKGERRILN----GFNG 265

  Fly   277 FATADEYTDSTLRVITVEKRQYGDYVCKATNRFGEAEARVNLF----------ETIIPVC 326
            ....::...|.|....|.:..||:|.|.|.|..|...|.:.|:          ..:.|.|
Zfish   266 VKIENKGKQSMLTFFNVSEEDYGNYTCVAINTLGITNASIILYGPGAIHDVNNAALSPTC 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LacNP_523713.2 IG_like 36..131 CDD:214653 21/106 (20%)
Ig strand B 46..50 CDD:409381 0/3 (0%)
Ig strand C 60..63 CDD:409381 1/2 (50%)
Ig strand E 96..100 CDD:409381 1/3 (33%)
Ig strand F 110..115 CDD:409381 2/4 (50%)
Ig strand G 124..127 CDD:409381 1/2 (50%)
Ig_3 134..208 CDD:464046 23/76 (30%)
Ig 227..318 CDD:472250 23/90 (26%)
Ig strand C 256..260 CDD:409353 0/3 (0%)
Ig strand E 286..290 CDD:409353 2/3 (67%)
Ig strand F 300..305 CDD:409353 2/4 (50%)
opcmlNP_001005580.1 Ig 41..129 CDD:472250 21/105 (20%)
Ig strand B 50..54 CDD:409353 0/3 (0%)
Ig strand C 62..66 CDD:409353 1/3 (33%)
Ig strand E 95..99 CDD:409353 1/3 (33%)
Ig strand F 109..114 CDD:409353 2/5 (40%)
Ig strand G 122..125 CDD:409353 1/2 (50%)
Ig 128..214 CDD:472250 28/92 (30%)
Ig strand B 150..154 CDD:409353 1/3 (33%)
Ig strand C 163..167 CDD:409353 1/3 (33%)
Ig strand E 181..185 CDD:409353 0/3 (0%)
Ig strand F 195..200 CDD:409353 2/4 (50%)
Ig 220..308 CDD:472250 24/92 (26%)
Ig strand B 236..240 CDD:409353 1/3 (33%)
Ig strand C 249..253 CDD:409353 0/3 (0%)
Ig strand E 275..279 CDD:409353 2/3 (67%)
Ig strand F 289..294 CDD:409353 2/4 (50%)
Ig strand G 302..305 CDD:409353 1/2 (50%)

Return to query results.
Submit another query.