| Sequence 1: | NP_523713.2 | Gene: | Lac / 36363 | FlyBaseID: | FBgn0010238 | Length: | 359 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001259868.1 | Gene: | robo2 / 44522 | FlyBaseID: | FBgn0002543 | Length: | 1519 | Species: | Drosophila melanogaster |
| Alignment Length: | 320 | Identity: | 85/320 - (26%) |
|---|---|---|---|
| Similarity: | 135/320 - (42%) | Gaps: | 51/320 - (15%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 12 STLLLAIFVQQTLAQRTPTISYITQEQIKDIGGTVEFDCSVQYAKEYNVLFLKTDSDPVFLSTGS 76
Fly 77 TLVIKDSRFSLRYDPNSSTYKLQIKDIQETDAGTYTCQVVISTVHKVSAEVKLSVRRPPVISDNS 141
Fly 142 TQSVVASEGSEVQMECYASGYPTPTITWRRENNA--ILP--TDSATYVGNT------LRIKSVKK 196
Fly 197 EDRG-TYYCVADNGV-SKGDRRNINVEVEFAPVITVPRPRLGQA-------LQYDMDLECHIEAY 252
Fly 253 PPPAIVWTKDDIQLANNQHYSISHFATADEYTDSTLRVITVEKRQYGDYVCKATNRFGEA 312 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Lac | NP_523713.2 | IG_like | 36..131 | CDD:214653 | 22/94 (23%) |
| FR1 | 37..50 | CDD:409353 | 4/12 (33%) | ||
| Ig strand A' | 37..42 | CDD:409353 | 1/4 (25%) | ||
| Ig strand B | 44..51 | CDD:409353 | 2/6 (33%) | ||
| CDR1 | 51..59 | CDD:409353 | 0/7 (0%) | ||
| Ig strand C | 59..63 | CDD:409353 | 2/3 (67%) | ||
| FR2 | 60..63 | CDD:409353 | 2/2 (100%) | ||
| CDR2 | 67..81 | CDD:409353 | 1/13 (8%) | ||
| Ig strand C' | 68..72 | CDD:409353 | 0/3 (0%) | ||
| Ig strand C' | 79..81 | CDD:409353 | 0/1 (0%) | ||
| FR3 | 84..115 | CDD:409353 | 9/30 (30%) | ||
| Ig strand D | 84..90 | CDD:409353 | 1/5 (20%) | ||
| Ig strand E | 94..102 | CDD:409353 | 1/7 (14%) | ||
| Ig strand F | 108..115 | CDD:409353 | 4/6 (67%) | ||
| CDR3 | 116..124 | CDD:409353 | 1/7 (14%) | ||
| FR4 | 124..130 | CDD:409353 | 1/5 (20%) | ||
| Ig strand G | 124..130 | CDD:409353 | 1/5 (20%) | ||
| Ig_3 | 134..208 | CDD:404760 | 28/84 (33%) | ||
| Ig strand B | 153..157 | CDD:409353 | 1/3 (33%) | ||
| Ig strand C | 166..170 | CDD:409353 | 1/3 (33%) | ||
| Ig strand E | 187..191 | CDD:409353 | 2/9 (22%) | ||
| Ig strand F | 201..206 | CDD:409353 | 1/4 (25%) | ||
| Ig strand G | 215..218 | CDD:409353 | 1/2 (50%) | ||
| Ig | 227..318 | CDD:416386 | 22/93 (24%) | ||
| Ig strand C | 256..260 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 286..290 | CDD:409353 | 2/3 (67%) | ||
| Ig strand F | 300..305 | CDD:409353 | 2/4 (50%) | ||
| robo2 | NP_001259868.1 | Ig1_Robo | 90..185 | CDD:143317 | |
| I-set | 91..184 | CDD:254352 | |||
| I-set | 190..279 | CDD:254352 | 2/5 (40%) | ||
| Ig2_Robo | 193..279 | CDD:143201 | 2/5 (40%) | ||
| I-set | 283..370 | CDD:254352 | 25/108 (23%) | ||
| Ig | 300..370 | CDD:299845 | 19/84 (23%) | ||
| Ig | 388..>457 | CDD:299845 | 25/68 (37%) | ||
| I-set | 479..561 | CDD:254352 | 21/87 (24%) | ||
| Ig | 496..561 | CDD:143165 | 19/70 (27%) | ||
| FN3 | 588..681 | CDD:238020 | |||
| FN3 | <817..856 | CDD:238020 | |||
| fn3 | 864..952 | CDD:278470 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR12231 |
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 2.010 | |||||