DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lac and Dscam3

DIOPT Version :9

Sequence 1:NP_523713.2 Gene:Lac / 36363 FlyBaseID:FBgn0010238 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_996226.2 Gene:Dscam3 / 42103 FlyBaseID:FBgn0261046 Length:2087 Species:Drosophila melanogaster


Alignment Length:372 Identity:98/372 - (26%)
Similarity:145/372 - (38%) Gaps:73/372 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PSISNCVWSTLLLAI------------------FVQQTLAQRTPTISYIT-----QEQIKDIGGT 45
            ||....:.|..||.|                  |.:|.:..|....||::     |.||.:.|||
  Fly   293 PSSQRVILSRTLLLIKNADERDAGKWICQASNQFGEQRIEIRLSVNSYVSVHILPQVQIVNSGGT 357

  Fly    46 VEFDCSVQYAKEYNVLFLKTDS--DPV-FLSTGSTL----VIKDSRFSLRYDPNSSTYKLQIKDI 103
            ..|:|:.            |.|  |.: :|..|..|    .:...|.::|:...||   |.::::
  Fly   358 ANFNCTT------------TGSAIDAIDWLHNGKPLQANNALTTGRDNIRFLSKSS---LLVQNV 407

  Fly   104 QETDAGTYTCQVVISTVH-KVSAEVKLSVRRPPVISDNSTQSVVASEGSEVQMECYASGYPTPTI 167
            ...|.|.|.|.|...... :..||:||....|.:|.....|:|  ..|..:.::|.|||.|.|..
  Fly   408 GRRDRGVYQCLVENQRASAQAMAELKLGDTVPELIYTFIEQNV--RPGPLISLKCSASGSPPPQF 470

  Fly   168 TWRRENNAILP------------TDSATYVGNTLRIKSVKKEDRGTYYCVADNGVSKGD-RRNIN 219
            .|..::..|:.            .|.:..|.:.|.|..|:.:|.|.|.|||.|  |.|. :.:..
  Fly   471 AWLLDSQPIMDVSLHHRFAIGQFVDMSGDVISHLNISHVRPDDGGLYKCVASN--SMGSVQHSAR 533

  Fly   220 VEVEFAPVITVPRPRLGQALQYDMDLECHIEAYPPPAIVWTKDDIQLANNQHYSISHFATADEYT 284
            :.|...|.:....|....|.: |:.:.|....||...|.|.|...:|..:.||.::..|...:  
  Fly   534 LNVYGPPYVRAIGPIKAVAGE-DIIVHCPFAGYPVEQIRWEKAHQELTTSNHYELASVADGGQ-- 595

  Fly   285 DSTLRVITVEK-RQYGDYVCKATNRFGEAEAR--VNLFETIIPVCPP 328
               |.:..||. |..|.|.|...:|.|| |||  :.|.....||..|
  Fly   596 ---LVIKNVEPGRDQGIYTCIVRSRAGE-EARRDMQLNVNSPPVIEP 638

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LacNP_523713.2 IG_like 36..131 CDD:214653 28/102 (27%)
FR1 37..50 CDD:409353 6/12 (50%)
Ig strand A' 37..42 CDD:409353 2/4 (50%)
Ig strand B 44..51 CDD:409353 3/6 (50%)
CDR1 51..59 CDD:409353 0/7 (0%)
Ig strand C 59..63 CDD:409353 0/3 (0%)
FR2 60..63 CDD:409353 0/2 (0%)
CDR2 67..81 CDD:409353 5/20 (25%)
Ig strand C' 68..72 CDD:409353 1/4 (25%)
Ig strand C' 79..81 CDD:409353 0/1 (0%)
FR3 84..115 CDD:409353 9/30 (30%)
Ig strand D 84..90 CDD:409353 2/5 (40%)
Ig strand E 94..102 CDD:409353 2/7 (29%)
Ig strand F 108..115 CDD:409353 3/6 (50%)
CDR3 116..124 CDD:409353 0/8 (0%)
FR4 124..130 CDD:409353 3/5 (60%)
Ig strand G 124..130 CDD:409353 3/5 (60%)
Ig_3 134..208 CDD:404760 24/85 (28%)
Ig strand B 153..157 CDD:409353 0/3 (0%)
Ig strand C 166..170 CDD:409353 0/3 (0%)
Ig strand E 187..191 CDD:409353 1/3 (33%)
Ig strand F 201..206 CDD:409353 2/4 (50%)
Ig strand G 215..218 CDD:409353 0/2 (0%)
Ig 227..318 CDD:416386 26/93 (28%)
Ig strand C 256..260 CDD:409353 1/3 (33%)
Ig strand E 286..290 CDD:409353 1/3 (33%)
Ig strand F 300..305 CDD:409353 2/4 (50%)
Dscam3NP_996226.2 IG 56..133 CDD:214652
Ig 56..125 CDD:143165
I-set 246..337 CDD:254352 9/43 (21%)
Ig 264..334 CDD:143165 8/40 (20%)
I-set 345..433 CDD:254352 26/102 (25%)
Ig 358..431 CDD:143165 18/87 (21%)
Ig 456..533 CDD:143165 22/78 (28%)
IGc2 553..619 CDD:197706 19/71 (27%)
I-set 634..724 CDD:254352 3/5 (60%)
ig 645..712 CDD:278476
IG_like 734..815 CDD:214653
Ig 745..815 CDD:299845
I-set 820..913 CDD:254352
Ig 838..920 CDD:299845
FN3 917..1033 CDD:238020
FN3 1040..1142 CDD:238020
fn3 1150..1237 CDD:278470
FN3 1263..1345 CDD:238020
Ig 1350..1436 CDD:299845
IG_like 1358..1436 CDD:214653
FN3 1441..1530 CDD:238020
FN3 1542..1620 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.