Sequence 1: | NP_523713.2 | Gene: | Lac / 36363 | FlyBaseID: | FBgn0010238 | Length: | 359 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001287297.1 | Gene: | dpr17 / 41470 | FlyBaseID: | FBgn0051361 | Length: | 664 | Species: | Drosophila melanogaster |
Alignment Length: | 206 | Identity: | 61/206 - (29%) |
---|---|---|---|
Similarity: | 90/206 - (43%) | Gaps: | 34/206 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 29 PTISYITQEQIKDIGGTVEFDCSVQYAKEYNVLFLKTDSDPVFLSTGSTLVIKDSRF-SLRYDPN 92
Fly 93 SSTYKLQIKDIQETDAGTYTCQVVISTVHKVSAEVKLSVRRP--PVISDNSTQSVVASEGSEVQM 155
Fly 156 ECYASGY--PTPTITWRRENNAILPTDSAT------------YVGN------TLRIKSVKKEDRG 200
Fly 201 TYYCVADNGVS 211 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Lac | NP_523713.2 | IG_like | 36..131 | CDD:214653 | 29/95 (31%) |
FR1 | 37..50 | CDD:409353 | 1/12 (8%) | ||
Ig strand A' | 37..42 | CDD:409353 | 0/4 (0%) | ||
Ig strand B | 44..51 | CDD:409353 | 0/6 (0%) | ||
CDR1 | 51..59 | CDD:409353 | 0/7 (0%) | ||
Ig strand C | 59..63 | CDD:409353 | 1/3 (33%) | ||
FR2 | 60..63 | CDD:409353 | 1/2 (50%) | ||
CDR2 | 67..81 | CDD:409353 | 3/13 (23%) | ||
Ig strand C' | 68..72 | CDD:409353 | 1/3 (33%) | ||
Ig strand C' | 79..81 | CDD:409353 | 0/1 (0%) | ||
FR3 | 84..115 | CDD:409353 | 13/31 (42%) | ||
Ig strand D | 84..90 | CDD:409353 | 3/6 (50%) | ||
Ig strand E | 94..102 | CDD:409353 | 4/7 (57%) | ||
Ig strand F | 108..115 | CDD:409353 | 4/6 (67%) | ||
CDR3 | 116..124 | CDD:409353 | 2/7 (29%) | ||
FR4 | 124..130 | CDD:409353 | 3/5 (60%) | ||
Ig strand G | 124..130 | CDD:409353 | 3/5 (60%) | ||
Ig_3 | 134..208 | CDD:404760 | 28/95 (29%) | ||
Ig strand B | 153..157 | CDD:409353 | 1/3 (33%) | ||
Ig strand C | 166..170 | CDD:409353 | 1/3 (33%) | ||
Ig strand E | 187..191 | CDD:409353 | 1/9 (11%) | ||
Ig strand F | 201..206 | CDD:409353 | 2/4 (50%) | ||
Ig strand G | 215..218 | CDD:409353 | |||
Ig | 227..318 | CDD:416386 | |||
Ig strand C | 256..260 | CDD:409353 | |||
Ig strand E | 286..290 | CDD:409353 | |||
Ig strand F | 300..305 | CDD:409353 | |||
dpr17 | NP_001287297.1 | IG_like | 414..491 | CDD:214653 | 21/82 (26%) |
Ig | 415..507 | CDD:299845 | 29/99 (29%) | ||
IG_like | 521..612 | CDD:214653 | 26/85 (31%) | ||
IGc2 | 524..605 | CDD:197706 | 24/80 (30%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |