DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lac and dpr5

DIOPT Version :9

Sequence 1:NP_523713.2 Gene:Lac / 36363 FlyBaseID:FBgn0010238 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster


Alignment Length:193 Identity:55/193 - (28%)
Similarity:88/193 - (45%) Gaps:28/193 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 QEQIKDIGGTVEFDCSVQYAKEYNVLFLKTDSDPVFLSTGSTLVIKDSRFSLRYDPNSSTYKLQI 100
            :|.|..:|.|....|.|::..:..|.::: ..|...|:.|......|.||..|:..||..:.|:|
  Fly    98 REVIAALGTTARLHCRVRHLGDRAVSWIR-QRDLHILTIGIMTYTNDQRFLARHIDNSDEWVLKI 161

  Fly   101 KDIQETDAGTYTCQVVISTVHKVSAEVKLSV--RRPPVISDNSTQSVVASEGSEVQMECYASGYP 163
            ..:|:.|||.|.|||  ||..|:|...||.|  .:..::::   :.:....||::.:.|.|...|
  Fly   162 VSVQQRDAGVYECQV--STEPKISLAYKLVVVTSKAQILAN---RELFIQSGSDINLTCIAPQAP 221

  Fly   164 TP--TITWRRENNAILPTDSATYVGNTLRIKS-------------VKKEDRGTYYCVADNGVS 211
            .|  .:.|.::..  |.:|||.   ..:|::|             |:..|.|.|.|.|||..|
  Fly   222 GPYTHMLWHKDTE--LVSDSAR---GGIRVESEQQMKTSNLVISRVQHTDSGNYTCSADNSNS 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LacNP_523713.2 IG_like 36..131 CDD:214653 32/94 (34%)
FR1 37..50 CDD:409353 4/12 (33%)
Ig strand A' 37..42 CDD:409353 2/4 (50%)
Ig strand B 44..51 CDD:409353 1/6 (17%)
CDR1 51..59 CDD:409353 1/7 (14%)
Ig strand C 59..63 CDD:409353 1/3 (33%)
FR2 60..63 CDD:409353 1/2 (50%)
CDR2 67..81 CDD:409353 3/13 (23%)
Ig strand C' 68..72 CDD:409353 1/3 (33%)
Ig strand C' 79..81 CDD:409353 0/1 (0%)
FR3 84..115 CDD:409353 13/30 (43%)
Ig strand D 84..90 CDD:409353 3/5 (60%)
Ig strand E 94..102 CDD:409353 2/7 (29%)
Ig strand F 108..115 CDD:409353 4/6 (67%)
CDR3 116..124 CDD:409353 3/7 (43%)
FR4 124..130 CDD:409353 2/5 (40%)
Ig strand G 124..130 CDD:409353 2/5 (40%)
Ig_3 134..208 CDD:404760 19/88 (22%)
Ig strand B 153..157 CDD:409353 0/3 (0%)
Ig strand C 166..170 CDD:409353 0/3 (0%)
Ig strand E 187..191 CDD:409353 0/3 (0%)
Ig strand F 201..206 CDD:409353 2/4 (50%)
Ig strand G 215..218 CDD:409353
Ig 227..318 CDD:416386
Ig strand C 256..260 CDD:409353
Ig strand E 286..290 CDD:409353
Ig strand F 300..305 CDD:409353
dpr5NP_650080.3 V-set 95..191 CDD:284989 32/95 (34%)
IG_like 98..179 CDD:214653 27/83 (33%)
IG_like 206..278 CDD:214653 21/76 (28%)
Ig 211..278 CDD:143165 19/71 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.