DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lac and dpr11

DIOPT Version :9

Sequence 1:NP_523713.2 Gene:Lac / 36363 FlyBaseID:FBgn0010238 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001262320.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster


Alignment Length:206 Identity:64/206 - (31%)
Similarity:84/206 - (40%) Gaps:27/206 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 YITQEQIKDIGGTVEFDCSVQYAKEYNVLFLKTDSDPVFLSTGSTLVIKDSRFSLRYDPNSSTYK 97
            |.|......||......|.|:.....:|.:::. .|...|:....:.|.|.||.....|: ..:.
  Fly   122 YATSNVTTQIGTHAYLPCRVKQLGNKSVSWIRL-RDGHILTVDRAVFIADQRFLAIKQPD-KYWT 184

  Fly    98 LQIKDIQETDAGTYTCQVVISTVHKVSAEVKLSVRRPPV-ISDNSTQSVVASEGSEVQMECYASG 161
            ||||.:|..|||:|.|||  ||..||||.|:|.|..|.. |.....:.|.|  ||.|.:.|...|
  Fly   185 LQIKYVQARDAGSYECQV--STEPKVSARVQLQVVVPRTEILGEPDRYVKA--GSNVVLRCIVRG 245

  Fly   162 --YPTPTITW-----------RRENNAILPT------DSATYVGNTLRIKSVKKEDRGTYYCVAD 207
              .|...|.|           ||....:.|.      :..:.:| :|.|:|.||.|.|.|.|...
  Fly   246 ALEPPTFIMWYHGAEQLAADSRRHRTQLDPNLPEASGEGQSTIG-SLIIESAKKRDTGNYTCSPS 309

  Fly   208 NGVSKGDRRNI 218
            |..|.....||
  Fly   310 NSPSATVTLNI 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LacNP_523713.2 IG_like 36..131 CDD:214653 32/94 (34%)
FR1 37..50 CDD:409353 2/12 (17%)
Ig strand A' 37..42 CDD:409353 0/4 (0%)
Ig strand B 44..51 CDD:409353 0/6 (0%)
CDR1 51..59 CDD:409353 1/7 (14%)
Ig strand C 59..63 CDD:409353 1/3 (33%)
FR2 60..63 CDD:409353 1/2 (50%)
CDR2 67..81 CDD:409353 2/13 (15%)
Ig strand C' 68..72 CDD:409353 1/3 (33%)
Ig strand C' 79..81 CDD:409353 0/1 (0%)
FR3 84..115 CDD:409353 13/30 (43%)
Ig strand D 84..90 CDD:409353 2/5 (40%)
Ig strand E 94..102 CDD:409353 3/7 (43%)
Ig strand F 108..115 CDD:409353 4/6 (67%)
CDR3 116..124 CDD:409353 3/7 (43%)
FR4 124..130 CDD:409353 3/5 (60%)
Ig strand G 124..130 CDD:409353 3/5 (60%)
Ig_3 134..208 CDD:404760 25/93 (27%)
Ig strand B 153..157 CDD:409353 1/3 (33%)
Ig strand C 166..170 CDD:409353 2/14 (14%)
Ig strand E 187..191 CDD:409353 1/3 (33%)
Ig strand F 201..206 CDD:409353 2/4 (50%)
Ig strand G 215..218 CDD:409353 0/2 (0%)
Ig 227..318 CDD:416386
Ig strand C 256..260 CDD:409353
Ig strand E 286..290 CDD:409353
Ig strand F 300..305 CDD:409353
dpr11NP_001262320.1 I-set 125..216 CDD:254352 32/94 (34%)
Ig 127..217 CDD:299845 32/93 (34%)
IG_like 227..320 CDD:214653 25/95 (26%)
IGc2 234..311 CDD:197706 21/77 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.