DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lac and LSAMP

DIOPT Version :10

Sequence 1:NP_523713.2 Gene:Lac / 36363 FlyBaseID:FBgn0010238 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001305844.1 Gene:LSAMP / 4045 HGNCID:6705 Length:361 Species:Homo sapiens


Alignment Length:307 Identity:93/307 - (30%)
Similarity:138/307 - (44%) Gaps:46/307 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 ITQEQIKDIGGTVEFDCSVQYAKEYNVLFLKTDSDPVFLSTGSTLVIKDSRFSLRYDP------- 91
            ||..|    |.|....|.|:          ..:|...:|:....:.....::||  ||       
Human    41 ITVRQ----GDTAILRCVVE----------DKNSKVAWLNRSGIIFAGHDKWSL--DPRVELEKR 89

  Fly    92 NSSTYKLQIKDIQETDAGTYTCQVVISTVHK-VSAEVKLSVRRPPVISDNSTQSVVASEGSEVQM 155
            :|..|.|:|:.:...|.|:|||.|  .|.|: .:::|.|.|:.||.|| |.:..|..:|||.|.:
Human    90 HSLEYSLRIQKVDVYDEGSYTCSV--QTQHEPKTSQVYLIVQVPPKIS-NISSDVTVNEGSNVTL 151

  Fly   156 ECYASGYPTPTITWRRENNAILPTDSATYVGNT--LRIKSVKKEDRGTYYCVADNGVSKGDRRNI 218
            .|.|:|.|.|.||||.    :.|| ...:.|..  |.|..:.:|..|.|.|.|.|.||..|.:.:
Human   152 VCMANGRPEPVITWRH----LTPT-GREFEGEEEYLEILGITREQSGKYECKAANEVSSADVKQV 211

  Fly   219 NVEVEFAPVITVPRPR---LGQALQYDMDLECHIEAYPPPAIVWTKDDIQLANNQHYSISHFATA 280
            .|.|.:.|.||..:..   .|:    ...|:|...|.|.|...|.:||.::  |....:...:|.
Human   212 KVTVNYPPTITESKSNEATTGR----QASLKCEASAVPAPDFEWYRDDTRI--NSANGLEIKSTE 270

  Fly   281 DEYTDSTLRVITVEKRQYGDYVCKATNRFGEAEARVNLFETIIPVCP 327
            .:   |:|.|..|.:..||:|.|.|.|:.|...|.:.||:.::|..|
Human   271 GQ---SSLTVTNVTEEHYGNYTCVAANKLGVTNASLVLFKRVLPTIP 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LacNP_523713.2 IG_like 36..131 CDD:214653 25/102 (25%)
Ig strand B 46..50 CDD:409381 0/3 (0%)
Ig strand C 60..63 CDD:409381 0/2 (0%)
Ig strand E 96..100 CDD:409381 2/3 (67%)
Ig strand F 110..115 CDD:409381 3/4 (75%)
Ig strand G 124..127 CDD:409381 0/2 (0%)
Ig_3 134..208 CDD:464046 29/75 (39%)
Ig 227..318 CDD:472250 25/93 (27%)
Ig strand C 256..260 CDD:409353 0/3 (0%)
Ig strand E 286..290 CDD:409353 2/3 (67%)
Ig strand F 300..305 CDD:409353 2/4 (50%)
LSAMPNP_001305844.1 Ig 38..128 CDD:472250 27/104 (26%)
Ig strand B 49..53 CDD:409353 0/3 (0%)
Ig strand C 61..65 CDD:409353 0/3 (0%)
Ig strand E 94..98 CDD:409353 2/3 (67%)
Ig strand F 108..113 CDD:409353 3/4 (75%)
Ig strand G 121..124 CDD:409353 0/2 (0%)
Ig_3 131..201 CDD:464046 29/75 (39%)
Ig_3 218..294 CDD:464046 23/84 (27%)

Return to query results.
Submit another query.