DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lac and IGLON5

DIOPT Version :9

Sequence 1:NP_523713.2 Gene:Lac / 36363 FlyBaseID:FBgn0010238 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001094842.1 Gene:IGLON5 / 402665 HGNCID:34550 Length:336 Species:Homo sapiens


Alignment Length:323 Identity:94/323 - (29%)
Similarity:129/323 - (39%) Gaps:69/323 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 VQQTLAQRTPTISYITQEQIKDIGGTVEFDC-------SVQYAKEYNVLFLKTD---SDP---VF 71
            :.|:|...:|..:|...|     |......|       .|.:....|:|:...|   |||   :.
Human    29 LSQSLEFNSPADNYTVCE-----GDNATLSCFIDEHVTRVAWLNRSNILYAGNDRWTSDPRVRLL 88

  Fly    72 LSTGSTLVIKDSRFSLRYDPNSSTYKLQIKDIQETDAGTYTCQVVISTVHK-VSAEVKLSVRRPP 135
            ::|                  ...:.:.|.::...|.|.|||.  ..|.|: .:.:|.|.|..|.
Human    89 INT------------------PEEFSILITEVGLGDEGLYTCS--FQTRHQPYTTQVYLIVHVPA 133

  Fly   136 VISDNSTQSVVASEGSEVQMECYASGYPTPTITWRRENNAILPTDSATYVGNTLRIKSVKKEDRG 200
            .|. |.:..|..:||..|.:.|.|.|.|.||:|||:..      |..|..|..|.|..:::...|
Human   134 RIV-NISSPVTVNEGGNVNLLCLAVGRPEPTVTWRQLR------DGFTSEGEILEISDIQRGQAG 191

  Fly   201 TYYCVADNGV-SKGDRRNINVEVEFAPVI---TVPRPRLGQALQYDMDLECHIEAYPPPAIVWTK 261
            .|.||..||| |..|.|.:.|.|.:.|.|   |..|..||:|..    |.|...|.||....|.|
Human   192 EYECVTHNGVNSAPDSRRVLVTVNYPPTITDVTSARTALGRAAL----LRCEAMAVPPADFQWYK 252

  Fly   262 DDIQLANNQHYSISHFATAD------EYTDSTLRVITVEKRQYGDYVCKATNRFGEAEARVNL 318
            ||..|::         .||:      |.|.|.|....|..|.||:|.|:|.||.|.:.|.:.|
Human   253 DDRLLSS---------GTAEGLKVQTERTRSMLLFANVSARHYGNYTCRAANRLGASSASMRL 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LacNP_523713.2 IG_like 36..131 CDD:214653 21/108 (19%)
FR1 37..50 CDD:409353 2/12 (17%)
Ig strand A' 37..42 CDD:409353 1/4 (25%)
Ig strand B 44..51 CDD:409353 1/13 (8%)
CDR1 51..59 CDD:409353 1/7 (14%)
Ig strand C 59..63 CDD:409353 2/3 (67%)
FR2 60..63 CDD:409353 1/2 (50%)
CDR2 67..81 CDD:409353 4/16 (25%)
Ig strand C' 68..72 CDD:409353 2/6 (33%)
Ig strand C' 79..81 CDD:409353 0/1 (0%)
FR3 84..115 CDD:409353 6/30 (20%)
Ig strand D 84..90 CDD:409353 0/5 (0%)
Ig strand E 94..102 CDD:409353 1/7 (14%)
Ig strand F 108..115 CDD:409353 4/6 (67%)
CDR3 116..124 CDD:409353 2/8 (25%)
FR4 124..130 CDD:409353 1/5 (20%)
Ig strand G 124..130 CDD:409353 1/5 (20%)
Ig_3 134..208 CDD:404760 25/73 (34%)
Ig strand B 153..157 CDD:409353 1/3 (33%)
Ig strand C 166..170 CDD:409353 2/3 (67%)
Ig strand E 187..191 CDD:409353 1/3 (33%)
Ig strand F 201..206 CDD:409353 2/4 (50%)
Ig strand G 215..218 CDD:409353 1/2 (50%)
Ig 227..318 CDD:416386 33/99 (33%)
Ig strand C 256..260 CDD:409353 0/3 (0%)
Ig strand E 286..290 CDD:409353 2/3 (67%)
Ig strand F 300..305 CDD:409353 2/4 (50%)
IGLON5NP_001094842.1 Ig 41..129 CDD:416386 22/112 (20%)
Ig strand A' 41..46 CDD:409353 1/4 (25%)
Ig strand B 48..56 CDD:409353 1/7 (14%)
CDR1 56..60 CDD:409353 0/3 (0%)
FR2 61..68 CDD:409353 1/6 (17%)
Ig strand C 61..67 CDD:409353 1/5 (20%)
CDR2 69..79 CDD:409353 3/9 (33%)
Ig strand C' 71..74 CDD:409353 1/2 (50%)
Ig strand C' 76..79 CDD:409353 1/2 (50%)
FR3 80..115 CDD:409353 10/54 (19%)
Ig strand D 84..91 CDD:409353 0/6 (0%)
Ig strand E 94..100 CDD:409353 0/5 (0%)
Ig strand F 107..115 CDD:409353 4/9 (44%)
CDR3 116..120 CDD:409353 2/3 (67%)
Ig strand G 120..129 CDD:409353 2/8 (25%)
FR4 122..129 CDD:409353 2/6 (33%)
Ig_3 134..199 CDD:404760 24/71 (34%)
Ig strand B 148..157 CDD:409353 2/8 (25%)
Ig strand C 162..170 CDD:409353 5/7 (71%)
Ig strand F 191..199 CDD:409353 4/7 (57%)
Ig strand G 202..212 CDD:409353 3/9 (33%)
Ig_3 217..295 CDD:404760 30/90 (33%)
putative Ig strand A 218..224 CDD:409353 2/5 (40%)
Ig strand B 234..238 CDD:409353 1/7 (14%)
Ig strand C 247..251 CDD:409353 0/3 (0%)
Ig strand E 274..278 CDD:409353 2/3 (67%)
Ig strand F 288..293 CDD:409353 2/4 (50%)
Ig strand G 301..304 CDD:409353 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143433
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 1 1.000 - - otm40772
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.