DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lac and dpr10

DIOPT Version :10

Sequence 1:NP_523713.2 Gene:Lac / 36363 FlyBaseID:FBgn0010238 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster


Alignment Length:337 Identity:68/337 - (20%)
Similarity:103/337 - (30%) Gaps:104/337 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 IGGTVEFDCSVQYAKEYNVLFLKTDSDPVFLSTGSTLVIKDSRFSLRYDPNSSTYKLQIKDIQET 106
            :|.:....|.|::.....|.::: ..|...|:.|:.....|.||...|..:...:.||||..|:.
  Fly    67 VGKSAYLGCRVKHLGNKTVAWIR-HRDLHILTVGTYTYTTDQRFQTSYHRDIDEWTLQIKWAQQR 130

  Fly   107 DAGTYTCQVVISTVHKVSAEVKLSVRRPPVISDNSTQSVVASEGSEVQMECYASGYPTPTITWRR 171
            |||.|.||:....|...|..:.:             ..::.:|.|::..:.|             
  Fly   131 DAGVYECQ
ISTQPVRSYSVNLNI-------------VDLIDAETSDIMQQYY------------- 169

  Fly   172 ENNAILPTDSATYVGNTLRIKSVKKEDRGTYYCVADNGVSKGDRRNINVEVEFAPVITVPRPRL- 235
                   .|.|.|:......:|...|..|.                      |.|:.||..|.. 
  Fly   170 -------NDDAFYIAENRVYQSSNDEFAGM----------------------FGPIQTVAVPTAT 205

  Fly   236 ---GQALQYD----MDLECHIE--AYPPPAIVWTKDDIQLANNQHYSISHFAT-ADEYTDSTLRV 290
               |..|..|    ::|.|.|:  ..||..|.|...|..|:.........|.| ..|.|.|.|.:
  Fly   206 ILGGPDLYVDKGSTINLTCIIKFSPEPPTHIFWYHQDKVLSEETSGGRLKFKTIKSEETKSILLI 270

  Fly   291 ITVEKRQYGDYVCKATN-----------------------------------RFGEAEARVNLFE 320
            ...:....|.|.|..:|                                   .||:|...|.:..
  Fly   271 YDADLLHSGKYSCYPSNTEIASIRVHVLQGERPEAMQTNAAPAAVALACWSCHFGQATQAVRVIS 335

  Fly   321 TIIP--VCPPAC 330
            |::.  |...||
  Fly   336 TMVAALVLLEAC 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LacNP_523713.2 IG_like 36..131 CDD:214653 24/88 (27%)
Ig strand B 46..50 CDD:409381 0/3 (0%)
Ig strand C 60..63 CDD:409381 1/2 (50%)
Ig strand E 96..100 CDD:409381 1/3 (33%)
Ig strand F 110..115 CDD:409381 2/4 (50%)
Ig strand G 124..127 CDD:409381 1/2 (50%)
Ig_3 134..208 CDD:464046 9/73 (12%)
Ig 227..318 CDD:472250 29/136 (21%)
Ig strand C 256..260 CDD:409353 1/3 (33%)
Ig strand E 286..290 CDD:409353 2/3 (67%)
Ig strand F 300..305 CDD:409353 2/4 (50%)
dpr10NP_729591.1 Ig 53..138 CDD:472250 20/71 (28%)
Ig strand B 71..75 CDD:409371 0/3 (0%)
Ig strand E 120..124 CDD:409371 1/3 (33%)
Ig_3 214..287 CDD:464046 19/72 (26%)

Return to query results.
Submit another query.