DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lac and babos

DIOPT Version :9

Sequence 1:NP_523713.2 Gene:Lac / 36363 FlyBaseID:FBgn0010238 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001286719.1 Gene:babos / 37557 FlyBaseID:FBgn0034724 Length:196 Species:Drosophila melanogaster


Alignment Length:141 Identity:32/141 - (22%)
Similarity:55/141 - (39%) Gaps:21/141 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 QQTLAQRTPTISYITQEQIKDI-------GGTVEFDCSV---QYAKEYNVLFLKTDSDPVFLSTG 75
            |...:.:|.:.:.:..|:|...       |..|...|.|   .::.:..||:...|:   .:|.|
  Fly    47 QSAPSPQTKSPNPVASEKINKTLSVTGIRGEDVVLKCDVGSNLHSSDVVVLWYFGDN---VISNG 108

  Fly    76 STLVIKDSRFSLRYDPNSSTYKLQIKDIQETDAGTYTCQVVISTVHKVSAEVKLSVRRPPVISDN 140
            ..||..:.:....||       |.|.......||:|.|:|:.|. ..|:.:|.::......|:..
  Fly   109 KNLVQPNFKLDANYD-------LTILKASPQVAGSYLCKVLPSG-SVVNTKVTIAEHSLDAIAPE 165

  Fly   141 STQSVVASEGS 151
            |:.|...|..|
  Fly   166 SSTSAAGSASS 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LacNP_523713.2 IG_like 36..131 CDD:214653 25/104 (24%)
FR1 37..50 CDD:409353 4/19 (21%)
Ig strand A' 37..42 CDD:409353 2/4 (50%)
Ig strand B 44..51 CDD:409353 1/6 (17%)
CDR1 51..59 CDD:409353 1/10 (10%)
Ig strand C 59..63 CDD:409353 2/3 (67%)
FR2 60..63 CDD:409353 2/2 (100%)
CDR2 67..81 CDD:409353 4/13 (31%)
Ig strand C' 68..72 CDD:409353 0/3 (0%)
Ig strand C' 79..81 CDD:409353 1/1 (100%)
FR3 84..115 CDD:409353 8/30 (27%)
Ig strand D 84..90 CDD:409353 0/5 (0%)
Ig strand E 94..102 CDD:409353 2/7 (29%)
Ig strand F 108..115 CDD:409353 4/6 (67%)
CDR3 116..124 CDD:409353 1/7 (14%)
FR4 124..130 CDD:409353 1/5 (20%)
Ig strand G 124..130 CDD:409353 1/5 (20%)
Ig_3 134..208 CDD:404760 5/18 (28%)
Ig strand B 153..157 CDD:409353
Ig strand C 166..170 CDD:409353
Ig strand E 187..191 CDD:409353
Ig strand F 201..206 CDD:409353
Ig strand G 215..218 CDD:409353
Ig 227..318 CDD:416386
Ig strand C 256..260 CDD:409353
Ig strand E 286..290 CDD:409353
Ig strand F 300..305 CDD:409353
babosNP_001286719.1 ig 70..154 CDD:278476 23/94 (24%)
IG_like 70..154 CDD:214653 23/94 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.