Sequence 1: | NP_523713.2 | Gene: | Lac / 36363 | FlyBaseID: | FBgn0010238 | Length: | 359 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001246162.1 | Gene: | Dscam1 / 35652 | FlyBaseID: | FBgn0033159 | Length: | 2038 | Species: | Drosophila melanogaster |
Alignment Length: | 356 | Identity: | 99/356 - (27%) |
---|---|---|---|
Similarity: | 151/356 - (42%) | Gaps: | 81/356 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 18 IFVQQTLAQRTPTIS------YITQEQIKDIGGTVEFDCSVQYAKEYNVLFLKTDSDPVFLSTGS 76
Fly 77 T----LVIKDSRFSLRYDPNSSTYKLQIKDIQETDAGTYTCQVVISTVHKVSAEVKLSVRRPPVI 137
Fly 138 S---DNSTQSVVASEGSEVQMECYASGYPTPTITWRRENNAILPTDSATYVGNTLRIKSVKKEDR 199
Fly 200 GTYYCVADNGVSKGDRRNINVEVE------FAPVITVPRPRLGQALQYD-------MDLECHIEA 251
Fly 252 YPPPAIVWTKDDIQLANNQHYSISHFATADEYTDSTLRVITVEKRQYGDYVCKATNRFGEAE--A 314
Fly 315 RVNLF----------------ETIIPVCPPA 329 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Lac | NP_523713.2 | IG_like | 36..131 | CDD:214653 | 29/98 (30%) |
FR1 | 37..50 | CDD:409353 | 2/12 (17%) | ||
Ig strand A' | 37..42 | CDD:409353 | 0/4 (0%) | ||
Ig strand B | 44..51 | CDD:409353 | 2/6 (33%) | ||
CDR1 | 51..59 | CDD:409353 | 1/7 (14%) | ||
Ig strand C | 59..63 | CDD:409353 | 1/3 (33%) | ||
FR2 | 60..63 | CDD:409353 | 1/2 (50%) | ||
CDR2 | 67..81 | CDD:409353 | 4/17 (24%) | ||
Ig strand C' | 68..72 | CDD:409353 | 0/3 (0%) | ||
Ig strand C' | 79..81 | CDD:409353 | 1/1 (100%) | ||
FR3 | 84..115 | CDD:409353 | 11/30 (37%) | ||
Ig strand D | 84..90 | CDD:409353 | 1/5 (20%) | ||
Ig strand E | 94..102 | CDD:409353 | 3/7 (43%) | ||
Ig strand F | 108..115 | CDD:409353 | 3/6 (50%) | ||
CDR3 | 116..124 | CDD:409353 | 2/7 (29%) | ||
FR4 | 124..130 | CDD:409353 | 2/5 (40%) | ||
Ig strand G | 124..130 | CDD:409353 | 2/5 (40%) | ||
Ig_3 | 134..208 | CDD:404760 | 26/76 (34%) | ||
Ig strand B | 153..157 | CDD:409353 | 0/3 (0%) | ||
Ig strand C | 166..170 | CDD:409353 | 1/3 (33%) | ||
Ig strand E | 187..191 | CDD:409353 | 1/3 (33%) | ||
Ig strand F | 201..206 | CDD:409353 | 2/4 (50%) | ||
Ig strand G | 215..218 | CDD:409353 | 0/2 (0%) | ||
Ig | 227..318 | CDD:416386 | 27/99 (27%) | ||
Ig strand C | 256..260 | CDD:409353 | 1/3 (33%) | ||
Ig strand E | 286..290 | CDD:409353 | 2/3 (67%) | ||
Ig strand F | 300..305 | CDD:409353 | 2/4 (50%) | ||
Dscam1 | NP_001246162.1 | Ig | 38..130 | CDD:299845 | |
IG | 57..133 | CDD:214652 | |||
IG_like | 267..343 | CDD:214653 | 29/90 (32%) | ||
Ig | 269..340 | CDD:143165 | 27/85 (32%) | ||
IG_like | 353..425 | CDD:214653 | 26/84 (31%) | ||
IGc2 | 361..413 | CDD:197706 | 20/57 (35%) | ||
I-set | 433..527 | CDD:254352 | 27/93 (29%) | ||
IGc2 | 446..517 | CDD:197706 | 19/70 (27%) | ||
I-set | 533..618 | CDD:254352 | 6/22 (27%) | ||
IGc2 | 544..607 | CDD:197706 | 6/11 (55%) | ||
Ig | 641..714 | CDD:143165 | |||
IGc2 | 735..804 | CDD:197706 | |||
I-set | 819..914 | CDD:254352 | |||
Ig | 833..921 | CDD:299845 | |||
FN3 | 918..1011 | CDD:238020 | |||
FN3 | 1018..1116 | CDD:238020 | |||
FN3 | 1124..1217 | CDD:238020 | |||
FN3 | 1222..1312 | CDD:238020 | |||
Ig | 1339..1406 | CDD:299845 | |||
FN3 | 1409..1499 | CDD:238020 | |||
FN3 | 1504..1584 | CDD:238020 | |||
Dscam_C | 1890..2008 | CDD:289151 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |