DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lac and bdl

DIOPT Version :9

Sequence 1:NP_523713.2 Gene:Lac / 36363 FlyBaseID:FBgn0010238 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster


Alignment Length:384 Identity:88/384 - (22%)
Similarity:133/384 - (34%) Gaps:117/384 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MWRPSISNCVW---STLLLAIFVQQTLAQR-----------TPTISYITQEQIKDIGGTVEFDCS 51
            |..|..|...|   ..||..:   |.|.:|           .||:       :.|:|   |::|.
  Fly   174 MKHPENSQASWYKDGVLLQEV---QDLVRRFYMGPDGSLSIDPTM-------MSDLG---EYECK 225

  Fly    52 V-------QYAKEY-------NVLFLKTDSDPVFLSTGSTLVI----------------KDSRFS 86
            |       |.||.:       .|::...:   |||..|...|:                ||....
  Fly   226 VRNSDGELQTAKAFLNIQYKAKVIYAPPE---VFLPYGQPAVLDCHFRANPPLKNLRWEKDGLLF 287

  Fly    87 LRYDPNSSTYKLQ----IKDIQETDAGTYTC-----------QVVISTVHKVSAEVKLSVRRPPV 136
            ..|:.....||:.    ...:.|..||:|||           ..|||.:          |.|||:
  Fly   288 DSYNVPGVFYKMNGSLFFAKVDENHAGSYTCTPYNDLGTDGPSPVISVI----------VLRPPI 342

  Fly   137 ISDNSTQSVVASEGSEVQMECYA---SGYPTPTITWRRENNAILPTDSATYVGNTLRIKSVKKED 198
            .|.......:...|...::.|.|   .|...|:|.|.|::...||.|..:..|..|.|..:.:.|
  Fly   343 FSVTPKAIYIQKLGEAAELPCEAIDRDGNNRPSIIWGRKDGQPLPADRFSLSGGNLTITGLVEGD 407

  Fly   199 RGTYYCVADNGVSKGDRRNINVEVEFAPVITVPRPRLGQALQYDMDLECHIEAYPPPAIVWTKDD 263
            ||.|.|.|.|     :...|..|.|.  :|....||....|..:....|....:.|.        
  Fly   408 RGIYECSATN-----EAATITAEAEL--MIENIAPRAPYNLTANSTETCITIRWQPG-------- 457

  Fly   264 IQLANNQHYSISH-FATADEYTDSTLRVI-------TVEKRQYG---DYVCKATNRFGE 311
             .|..|..|::.: ...|.|:  .||||:       ||:..|.|   :::..:.:::|:
  Fly   458 -YLRPNLEYTVWYRLMEAPEW--RTLRVLDKKVMEATVQHLQPGKEYEFMVLSQDKYGD 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LacNP_523713.2 IG_like 36..131 CDD:214653 28/139 (20%)
FR1 37..50 CDD:409353 3/12 (25%)
Ig strand A' 37..42 CDD:409353 0/4 (0%)
Ig strand B 44..51 CDD:409353 1/6 (17%)
CDR1 51..59 CDD:409353 4/21 (19%)
Ig strand C 59..63 CDD:409353 1/3 (33%)
FR2 60..63 CDD:409353 1/2 (50%)
CDR2 67..81 CDD:409353 5/29 (17%)
Ig strand C' 68..72 CDD:409353 1/3 (33%)
Ig strand C' 79..81 CDD:409353 1/17 (6%)
FR3 84..115 CDD:409353 9/45 (20%)
Ig strand D 84..90 CDD:409353 0/5 (0%)
Ig strand E 94..102 CDD:409353 2/11 (18%)
Ig strand F 108..115 CDD:409353 5/17 (29%)
CDR3 116..124 CDD:409353 3/7 (43%)
FR4 124..130 CDD:409353 0/5 (0%)
Ig strand G 124..130 CDD:409353 0/5 (0%)
Ig_3 134..208 CDD:404760 23/76 (30%)
Ig strand B 153..157 CDD:409353 0/3 (0%)
Ig strand C 166..170 CDD:409353 1/3 (33%)
Ig strand E 187..191 CDD:409353 1/3 (33%)
Ig strand F 201..206 CDD:409353 2/4 (50%)
Ig strand G 215..218 CDD:409353 0/2 (0%)
Ig 227..318 CDD:416386 20/96 (21%)
Ig strand C 256..260 CDD:409353 0/3 (0%)
Ig strand E 286..290 CDD:409353 2/3 (67%)
Ig strand F 300..305 CDD:409353 0/4 (0%)
bdlNP_608822.1 IG_like 42..128 CDD:214653
Ig 43..131 CDD:299845
I-set 153..242 CDD:254352 19/80 (24%)
Ig 157..242 CDD:299845 19/80 (24%)
Ig_2 252..337 CDD:290606 19/97 (20%)
IG_like 260..327 CDD:214653 13/66 (20%)
I-set 341..428 CDD:254352 25/91 (27%)
IGc2 356..419 CDD:197706 21/67 (31%)
FN3 435..524 CDD:238020 19/90 (21%)
FN3 554..636 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.