Sequence 1: | NP_523713.2 | Gene: | Lac / 36363 | FlyBaseID: | FBgn0010238 | Length: | 359 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005166847.1 | Gene: | itgb4 / 335269 | ZFINID: | ZDB-GENE-030131-7209 | Length: | 1931 | Species: | Danio rerio |
Alignment Length: | 313 | Identity: | 60/313 - (19%) |
---|---|---|---|
Similarity: | 104/313 - (33%) | Gaps: | 91/313 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 33 YITQEQIKDIGGTVEFDCSVQYAKEYNVLFLKTDSD--------PVFLSTGSTLVIKDSRFSLRY 89
Fly 90 DPNSSTYKLQIKDIQETDAGTYTCQVVISTVHKVSAEVKLSVRRPPVISDNSTQSVVASEGSEVQ 154
Fly 155 MECYASGYPTPTITWRRENNAILPTDSATY-VGNTLRIKSVKKEDRGTYYCVADNGVSKGDRRNI 218
Fly 219 NVEVEFAPVITVPR--PRLGQALQYDMDLECHIEAYPPPAIVWTKDDIQLANNQHYSISHFATAD 281
Fly 282 EYTDSTLRVITVEKRQYGDYVCKAT--------NRF----------GEAEARV 316 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Lac | NP_523713.2 | IG_like | 36..131 | CDD:214653 | 18/102 (18%) |
FR1 | 37..50 | CDD:409353 | 5/12 (42%) | ||
Ig strand A' | 37..42 | CDD:409353 | 1/4 (25%) | ||
Ig strand B | 44..51 | CDD:409353 | 4/6 (67%) | ||
CDR1 | 51..59 | CDD:409353 | 1/7 (14%) | ||
Ig strand C | 59..63 | CDD:409353 | 1/3 (33%) | ||
FR2 | 60..63 | CDD:409353 | 1/2 (50%) | ||
CDR2 | 67..81 | CDD:409353 | 3/21 (14%) | ||
Ig strand C' | 68..72 | CDD:409353 | 2/11 (18%) | ||
Ig strand C' | 79..81 | CDD:409353 | 0/1 (0%) | ||
FR3 | 84..115 | CDD:409353 | 3/30 (10%) | ||
Ig strand D | 84..90 | CDD:409353 | 0/5 (0%) | ||
Ig strand E | 94..102 | CDD:409353 | 1/7 (14%) | ||
Ig strand F | 108..115 | CDD:409353 | 1/6 (17%) | ||
CDR3 | 116..124 | CDD:409353 | 1/7 (14%) | ||
FR4 | 124..130 | CDD:409353 | 0/5 (0%) | ||
Ig strand G | 124..130 | CDD:409353 | 0/5 (0%) | ||
Ig_3 | 134..208 | CDD:404760 | 13/74 (18%) | ||
Ig strand B | 153..157 | CDD:409353 | 0/3 (0%) | ||
Ig strand C | 166..170 | CDD:409353 | 1/3 (33%) | ||
Ig strand E | 187..191 | CDD:409353 | 1/3 (33%) | ||
Ig strand F | 201..206 | CDD:409353 | 0/4 (0%) | ||
Ig strand G | 215..218 | CDD:409353 | 0/2 (0%) | ||
Ig | 227..318 | CDD:416386 | 22/110 (20%) | ||
Ig strand C | 256..260 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 286..290 | CDD:409353 | 1/3 (33%) | ||
Ig strand F | 300..305 | CDD:409353 | 0/4 (0%) | ||
itgb4 | XP_005166847.1 | Integrin_beta | 37..457 | CDD:278776 | |
EGF_2 | <468..490 | CDD:285248 | |||
EGF_2 | 545..573 | CDD:285248 | |||
Integrin_B_tail | 625..709 | CDD:285239 | |||
Calx-beta | 991..1064 | CDD:295344 | 16/98 (16%) | ||
FN3 | 1242..1326 | CDD:238020 | |||
FN3 | 1331..1420 | CDD:238020 | |||
fn3 | 1640..1720 | CDD:278470 | |||
fn3 | 1751..1835 | CDD:278470 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |