Sequence 1: | NP_523713.2 | Gene: | Lac / 36363 | FlyBaseID: | FBgn0010238 | Length: | 359 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_573262.2 | Gene: | CG6867 / 32782 | FlyBaseID: | FBgn0030887 | Length: | 949 | Species: | Drosophila melanogaster |
Alignment Length: | 207 | Identity: | 66/207 - (31%) |
---|---|---|---|
Similarity: | 95/207 - (45%) | Gaps: | 22/207 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 134 PPVISD----NSTQSVVASEGSEVQMECYASGYPTPTITWRRENNAIL---PTDSATYVGNTLRI 191
Fly 192 KSVKKEDRGTYYCVADNGVSKGDRRNINVEVEFAPVITVPRPRLGQALQYDMDLECHIEAYPPPA 256
Fly 257 IVWTK--DDIQLANNQHYSISH----FATADEYTDSTLRVITVEKRQYGDYVCKATNRFGEAEAR 315
Fly 316 VNLFETIIPVCP 327 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Lac | NP_523713.2 | IG_like | 36..131 | CDD:214653 | |
FR1 | 37..50 | CDD:409353 | |||
Ig strand A' | 37..42 | CDD:409353 | |||
Ig strand B | 44..51 | CDD:409353 | |||
CDR1 | 51..59 | CDD:409353 | |||
Ig strand C | 59..63 | CDD:409353 | |||
FR2 | 60..63 | CDD:409353 | |||
CDR2 | 67..81 | CDD:409353 | |||
Ig strand C' | 68..72 | CDD:409353 | |||
Ig strand C' | 79..81 | CDD:409353 | |||
FR3 | 84..115 | CDD:409353 | |||
Ig strand D | 84..90 | CDD:409353 | |||
Ig strand E | 94..102 | CDD:409353 | |||
Ig strand F | 108..115 | CDD:409353 | |||
CDR3 | 116..124 | CDD:409353 | |||
FR4 | 124..130 | CDD:409353 | |||
Ig strand G | 124..130 | CDD:409353 | |||
Ig_3 | 134..208 | CDD:404760 | 24/80 (30%) | ||
Ig strand B | 153..157 | CDD:409353 | 0/3 (0%) | ||
Ig strand C | 166..170 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 187..191 | CDD:409353 | 1/3 (33%) | ||
Ig strand F | 201..206 | CDD:409353 | 2/4 (50%) | ||
Ig strand G | 215..218 | CDD:409353 | 0/2 (0%) | ||
Ig | 227..318 | CDD:416386 | 29/96 (30%) | ||
Ig strand C | 256..260 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 286..290 | CDD:409353 | 2/3 (67%) | ||
Ig strand F | 300..305 | CDD:409353 | 2/4 (50%) | ||
CG6867 | NP_573262.2 | Collagen | 306..364 | CDD:189968 | |
IG_like | 442..525 | CDD:214653 | 23/82 (28%) | ||
IGc2 | 449..511 | CDD:197706 | 19/61 (31%) | ||
IG_like | 544..612 | CDD:214653 | 23/75 (31%) | ||
Ig | 546..612 | CDD:143165 | 23/73 (32%) | ||
OLF | 694..937 | CDD:280371 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D265311at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.920 |