Sequence 1: | NP_523713.2 | Gene: | Lac / 36363 | FlyBaseID: | FBgn0010238 | Length: | 359 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_036019026.1 | Gene: | Negr1 / 320840 | MGIID: | 2444846 | Length: | 362 | Species: | Mus musculus |
Alignment Length: | 342 | Identity: | 104/342 - (30%) |
---|---|---|---|
Similarity: | 151/342 - (44%) | Gaps: | 61/342 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 43 GGTVEFDCSVQYAKEYNVLFLKTD------------SDPVFLSTGSTLVIKDSRFSLRYDP---- 91
Fly 92 ---NSSTYKLQIKDIQETDAGTYTCQVVISTVHKV-SAEVKLSVRRPPVISDNSTQSVVASEGSE 152
Fly 153 VQMECYASGYPTPTITWRRENNAILPTDSATYVGNTLRIKSVKKEDRGTYYCVADNGVSKGDRRN 217
Fly 218 INVEVEFAPVI------TVPRPRLGQALQYDMDLECHIEAYPPPAIVWTKDDIQLANNQH-YSIS 275
Fly 276 HFATADEYTDSTLRVITVEKRQYGDYVCKATNRFGEAEARVNLFETIIPVC-------PPACGQA 333
Fly 334 YIAGA--EDVSATSFAL 348 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Lac | NP_523713.2 | IG_like | 36..131 | CDD:214653 | 30/107 (28%) |
FR1 | 37..50 | CDD:409353 | 3/6 (50%) | ||
Ig strand A' | 37..42 | CDD:409353 | |||
Ig strand B | 44..51 | CDD:409353 | 2/6 (33%) | ||
CDR1 | 51..59 | CDD:409353 | 1/7 (14%) | ||
Ig strand C | 59..63 | CDD:409353 | 2/3 (67%) | ||
FR2 | 60..63 | CDD:409353 | 1/2 (50%) | ||
CDR2 | 67..81 | CDD:409353 | 3/13 (23%) | ||
Ig strand C' | 68..72 | CDD:409353 | 0/3 (0%) | ||
Ig strand C' | 79..81 | CDD:409353 | 0/1 (0%) | ||
FR3 | 84..115 | CDD:409353 | 14/37 (38%) | ||
Ig strand D | 84..90 | CDD:409353 | 1/5 (20%) | ||
Ig strand E | 94..102 | CDD:409353 | 4/7 (57%) | ||
Ig strand F | 108..115 | CDD:409353 | 4/6 (67%) | ||
CDR3 | 116..124 | CDD:409353 | 2/8 (25%) | ||
FR4 | 124..130 | CDD:409353 | 1/5 (20%) | ||
Ig strand G | 124..130 | CDD:409353 | 1/5 (20%) | ||
Ig_3 | 134..208 | CDD:404760 | 24/73 (33%) | ||
Ig strand B | 153..157 | CDD:409353 | 1/3 (33%) | ||
Ig strand C | 166..170 | CDD:409353 | 1/3 (33%) | ||
Ig strand E | 187..191 | CDD:409353 | 1/3 (33%) | ||
Ig strand F | 201..206 | CDD:409353 | 2/4 (50%) | ||
Ig strand G | 215..218 | CDD:409353 | 0/2 (0%) | ||
Ig | 227..318 | CDD:416386 | 29/97 (30%) | ||
Ig strand C | 256..260 | CDD:409353 | 1/3 (33%) | ||
Ig strand E | 286..290 | CDD:409353 | 2/3 (67%) | ||
Ig strand F | 300..305 | CDD:409353 | 2/4 (50%) | ||
Negr1 | XP_036019026.1 | FR1 | 38..55 | CDD:409353 | 4/16 (25%) |
Ig strand A' | 40..46 | CDD:409353 | 2/5 (40%) | ||
IG_like | 41..129 | CDD:214653 | 26/91 (29%) | ||
Ig strand B | 48..56 | CDD:409353 | 1/7 (14%) | ||
CDR1 | 56..60 | CDD:409353 | 0/3 (0%) | ||
FR2 | 61..68 | CDD:409353 | 2/6 (33%) | ||
Ig strand C | 61..67 | CDD:409353 | 1/5 (20%) | ||
CDR2 | 69..79 | CDD:409353 | 1/9 (11%) | ||
Ig strand C' | 71..74 | CDD:409353 | 0/2 (0%) | ||
Ig strand C' | 76..79 | CDD:409353 | 0/2 (0%) | ||
FR3 | 80..115 | CDD:409353 | 15/38 (39%) | ||
Ig strand D | 84..91 | CDD:409353 | 0/6 (0%) | ||
Ig strand E | 94..100 | CDD:409353 | 3/5 (60%) | ||
Ig strand F | 107..115 | CDD:409353 | 5/9 (56%) | ||
CDR3 | 116..120 | CDD:409353 | 2/3 (67%) | ||
Ig strand G | 120..129 | CDD:409353 | 2/8 (25%) | ||
FR4 | 122..129 | CDD:409353 | 2/6 (33%) | ||
Ig strand A' | 139..144 | CDD:409353 | 1/4 (25%) | ||
IGc2 | 146..204 | CDD:197706 | 20/61 (33%) | ||
Ig strand B | 150..157 | CDD:409353 | 2/6 (33%) | ||
Ig strand C | 163..168 | CDD:409353 | 2/4 (50%) | ||
Ig strand C' | 170..172 | CDD:409353 | 0/1 (0%) | ||
Ig strand E | 180..186 | CDD:409353 | 3/9 (33%) | ||
Ig strand F | 193..200 | CDD:409353 | 3/6 (50%) | ||
Ig_3 | 219..295 | CDD:404760 | 27/87 (31%) | ||
putative Ig strand A | 219..225 | CDD:409353 | 2/5 (40%) | ||
Ig strand B | 235..239 | CDD:409353 | 1/10 (10%) | ||
Ig strand C | 248..252 | CDD:409353 | 1/3 (33%) | ||
Ig strand E | 274..278 | CDD:409353 | 2/3 (67%) | ||
Ig strand F | 288..293 | CDD:409353 | 2/4 (50%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167833587 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 1 | 1.000 | - | - | H41447 | |
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000150 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R6406 |
SonicParanoid | 1 | 1.000 | - | - | X97 | |
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
8 | 7.770 |