| Sequence 1: | NP_523713.2 | Gene: | Lac / 36363 | FlyBaseID: | FBgn0010238 | Length: | 359 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001101611.1 | Gene: | Dscaml1 / 315615 | RGDID: | 1304887 | Length: | 2111 | Species: | Rattus norvegicus |
| Alignment Length: | 307 | Identity: | 83/307 - (27%) |
|---|---|---|---|
| Similarity: | 126/307 - (41%) | Gaps: | 39/307 - (12%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 25 AQRTPTISYITQEQIKDIGGTVEFDCSVQYAKEYNVLFLKTDSDPVFLSTGSTLVIKDSRFSLRY 89
Fly 90 DPNSSTYKLQIKDIQETDAGTYTCQVVISTVHKVSAEVKLSVRRPPVISDNSTQSVVASEGSEVQ 154
Fly 155 MECYASGYPTPTITWRRENNAILPTDSATYVG---NTLRIKSVKKEDRGTYYCVADNGVSKGDRR 216
Fly 217 NINVEVEFAPVITVP-RPRLGQALQ-------YDMDLECHIEAYPPPAIVWTKDDIQLANNQHYS 273
Fly 274 ISHFATADEYTDSTLRVITVEKRQYGDYVCKATNRFGEAE--ARVNL 318 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Lac | NP_523713.2 | IG_like | 36..131 | CDD:214653 | 26/94 (28%) |
| FR1 | 37..50 | CDD:409353 | 4/12 (33%) | ||
| Ig strand A' | 37..42 | CDD:409353 | 1/4 (25%) | ||
| Ig strand B | 44..51 | CDD:409353 | 2/6 (33%) | ||
| CDR1 | 51..59 | CDD:409353 | 1/7 (14%) | ||
| Ig strand C | 59..63 | CDD:409353 | 0/3 (0%) | ||
| FR2 | 60..63 | CDD:409353 | 0/2 (0%) | ||
| CDR2 | 67..81 | CDD:409353 | 3/13 (23%) | ||
| Ig strand C' | 68..72 | CDD:409353 | 0/3 (0%) | ||
| Ig strand C' | 79..81 | CDD:409353 | 0/1 (0%) | ||
| FR3 | 84..115 | CDD:409353 | 10/30 (33%) | ||
| Ig strand D | 84..90 | CDD:409353 | 2/5 (40%) | ||
| Ig strand E | 94..102 | CDD:409353 | 2/7 (29%) | ||
| Ig strand F | 108..115 | CDD:409353 | 4/6 (67%) | ||
| CDR3 | 116..124 | CDD:409353 | 1/7 (14%) | ||
| FR4 | 124..130 | CDD:409353 | 1/5 (20%) | ||
| Ig strand G | 124..130 | CDD:409353 | 1/5 (20%) | ||
| Ig_3 | 134..208 | CDD:404760 | 23/76 (30%) | ||
| Ig strand B | 153..157 | CDD:409353 | 1/3 (33%) | ||
| Ig strand C | 166..170 | CDD:409353 | 2/3 (67%) | ||
| Ig strand E | 187..191 | CDD:409353 | 2/3 (67%) | ||
| Ig strand F | 201..206 | CDD:409353 | 2/4 (50%) | ||
| Ig strand G | 215..218 | CDD:409353 | 1/2 (50%) | ||
| Ig | 227..318 | CDD:416386 | 25/100 (25%) | ||
| Ig strand C | 256..260 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 286..290 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 300..305 | CDD:409353 | 2/4 (50%) | ||
| Dscaml1 | NP_001101611.1 | IG | 101..173 | CDD:214652 | |
| IGc2 | 101..168 | CDD:197706 | |||
| Ig | 183..276 | CDD:299845 | |||
| IG_like | 195..276 | CDD:214653 | |||
| I-set | 291..369 | CDD:254352 | 26/94 (28%) | ||
| IGc2 | 298..359 | CDD:197706 | 23/77 (30%) | ||
| IGc2 | 386..447 | CDD:197706 | 22/68 (32%) | ||
| I-set | 466..560 | CDD:254352 | 25/93 (27%) | ||
| Ig | 466..556 | CDD:299845 | 23/89 (26%) | ||
| IGc2 | 577..635 | CDD:197706 | |||
| IG_like | 665..744 | CDD:214653 | |||
| Ig | 673..739 | CDD:143165 | |||
| I-set | 748..843 | CDD:254352 | |||
| Ig7_DSCAM | 765..843 | CDD:143211 | |||
| I-set | 849..942 | CDD:254352 | |||
| Ig | 861..949 | CDD:299845 | |||
| FN3 | 945..1039 | CDD:238020 | |||
| FN3 | 1046..1143 | CDD:238020 | |||
| fn3 | 1151..1237 | CDD:278470 | |||
| FN3 | 1249..1340 | CDD:238020 | |||
| IGc2 | 1364..1428 | CDD:197706 | |||
| FN3 | 1442..1532 | CDD:238020 | |||
| FN3 | 1546..1618 | CDD:238020 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||