| Sequence 1: | NP_523713.2 | Gene: | Lac / 36363 | FlyBaseID: | FBgn0010238 | Length: | 359 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001363879.1 | Gene: | Igsf9b / 315510 | RGDID: | 1564717 | Length: | 1441 | Species: | Rattus norvegicus |
| Alignment Length: | 291 | Identity: | 74/291 - (25%) |
|---|---|---|---|
| Similarity: | 120/291 - (41%) | Gaps: | 45/291 - (15%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 69 PVFLSTGSTLVIKDSRFSLR---YDPNSSTYKLQIKDIQETDAGTYTCQVVI-----STVHKVSA 125
Fly 126 EVKLSVRRPPVISDNSTQSVVASEGSEVQMECYASGYPTPTITWRRENNAILPTDSATYVGNTLR 190
Fly 191 IKSVKKEDRGTYYCVADNGVSKGDR-RNINVEVEFAPVITVPRPRLGQALQYDMDLECHIEAYPP 254
Fly 255 PAI---VWTKDDIQLANNQHYSISHFATADEYTDSTLRVITVEKRQYGDYVCKATNRFGEA---- 312
Fly 313 -------EARV-NLFETI-IPV-------CP 327 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Lac | NP_523713.2 | IG_like | 36..131 | CDD:214653 | 17/69 (25%) |
| FR1 | 37..50 | CDD:409353 | |||
| Ig strand A' | 37..42 | CDD:409353 | |||
| Ig strand B | 44..51 | CDD:409353 | |||
| CDR1 | 51..59 | CDD:409353 | |||
| Ig strand C | 59..63 | CDD:409353 | |||
| FR2 | 60..63 | CDD:409353 | |||
| CDR2 | 67..81 | CDD:409353 | 3/11 (27%) | ||
| Ig strand C' | 68..72 | CDD:409353 | 1/2 (50%) | ||
| Ig strand C' | 79..81 | CDD:409353 | 0/1 (0%) | ||
| FR3 | 84..115 | CDD:409353 | 8/33 (24%) | ||
| Ig strand D | 84..90 | CDD:409353 | 1/8 (13%) | ||
| Ig strand E | 94..102 | CDD:409353 | 1/7 (14%) | ||
| Ig strand F | 108..115 | CDD:409353 | 3/6 (50%) | ||
| CDR3 | 116..124 | CDD:409353 | 2/12 (17%) | ||
| FR4 | 124..130 | CDD:409353 | 1/5 (20%) | ||
| Ig strand G | 124..130 | CDD:409353 | 1/5 (20%) | ||
| Ig_3 | 134..208 | CDD:404760 | 25/73 (34%) | ||
| Ig strand B | 153..157 | CDD:409353 | 1/3 (33%) | ||
| Ig strand C | 166..170 | CDD:409353 | 1/3 (33%) | ||
| Ig strand E | 187..191 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 201..206 | CDD:409353 | 2/4 (50%) | ||
| Ig strand G | 215..218 | CDD:409353 | 0/3 (0%) | ||
| Ig | 227..318 | CDD:416386 | 23/105 (22%) | ||
| Ig strand C | 256..260 | CDD:409353 | 0/6 (0%) | ||
| Ig strand E | 286..290 | CDD:409353 | 2/3 (67%) | ||
| Ig strand F | 300..305 | CDD:409353 | 2/4 (50%) | ||
| Igsf9b | NP_001363879.1 | PHA03247 | <898..1246 | CDD:223021 | |
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 918..1044 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1111..1332 | ||||
| Ig | 41..115 | CDD:319273 | 12/48 (25%) | ||
| I-set | 139..225 | CDD:369462 | 25/87 (29%) | ||
| Ig | 229..321 | CDD:386229 | 21/97 (22%) | ||
| Ig | <353..414 | CDD:386229 | |||
| Ig | 438..502 | CDD:319273 | |||
| FN3 | 510..605 | CDD:238020 | |||
| FN3 | 621..703 | CDD:238020 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 762..821 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 1 | 1.000 | 58 | 1.000 | Domainoid score | I10516 |
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR12231 |
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 5 | 4.910 | |||||