DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lac and rst

DIOPT Version :9

Sequence 1:NP_523713.2 Gene:Lac / 36363 FlyBaseID:FBgn0010238 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001284835.1 Gene:rst / 31290 FlyBaseID:FBgn0003285 Length:764 Species:Drosophila melanogaster


Alignment Length:333 Identity:86/333 - (25%)
Similarity:123/333 - (36%) Gaps:81/333 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 VFLSTGSTLVIKDS-RFSLRYDPNSS--TYKLQIKDIQETDAGTYTCQVVISTVHK------VSA 125
            |.:||||.:|.... |...|.|.|.|  .|:..|.|  |...|....::||..|.:      |..
  Fly   263 VHMSTGSRIVEHSQVRLECRADANPSDVRYRWFIND--EPIIGGQKTEMVIRNVTRKFHDAIVKC 325

  Fly   126 EVKLSVRRPPVISDNST-------------QSVVASEGSEVQMECYASGYPTPTITWRRENNAIL 177
            ||:.||.:.   .|:.|             ||:.|..||.|.:.|.....|.|.|.|.:.     
  Fly   326 EVQNSVGKS---EDSETLDISYAPSFRQRPQSMEADVGSVVSLTCEVDSNPQPEIVWIQH----- 382

  Fly   178 PTDSATYVGNTLRIK-SVKKEDRGTYYCVADNGVSKGDRRNINVEVEF---APVITVPRPRLG-Q 237
            |:|..  ||.:..:. ||..|..|.|||.|          |:....|.   |.|.....|.:| |
  Fly   383 PSDRV--VGTSTNLTFSVSNETAGRYYCKA----------NVPGYAEISADAYVYLKGSPAIGSQ 435

  Fly   238 ALQYDM-----DLECHIEAYPPPA-IVWT--KDDIQLANNQHYSISHFATADEYTDSTLRVITVE 294
            ..||.:     .:||...:.|... :.||  ..:|...:...|||...|.... ..|||.:...:
  Fly   436 RTQYGLVGDTARIECFASSVPRARHVSWTFNGQEISSESGHDYSILVDAVPGG-VKSTLIIRDSQ 499

  Fly   295 KRQYGDYVCKATNRFG--------EAEARVNLFETIIPVCPPACGQAYIAGAEDVSATSFALVGI 351
            ...||.|.|...|.:|        :|:..|:|..||:               ..:|..:|.||..
  Fly   500 AYHYGKYNCTVVNDYGNDVAEIQLQAKKSVSLLMTIV---------------GGISVVAFLLVLT 549

  Fly   352 LAALLFAR 359
            :..:::.:
  Fly   550 ILVVVYIK 557

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LacNP_523713.2 IG_like 36..131 CDD:214653 22/69 (32%)
FR1 37..50 CDD:409353
Ig strand A' 37..42 CDD:409353
Ig strand B 44..51 CDD:409353
CDR1 51..59 CDD:409353
Ig strand C 59..63 CDD:409353
FR2 60..63 CDD:409353
CDR2 67..81 CDD:409353 6/10 (60%)
Ig strand C' 68..72 CDD:409353 1/1 (100%)
Ig strand C' 79..81 CDD:409353 1/1 (100%)
FR3 84..115 CDD:409353 10/32 (31%)
Ig strand D 84..90 CDD:409353 2/5 (40%)
Ig strand E 94..102 CDD:409353 3/9 (33%)
Ig strand F 108..115 CDD:409353 1/6 (17%)
CDR3 116..124 CDD:409353 3/13 (23%)
FR4 124..130 CDD:409353 2/5 (40%)
Ig strand G 124..130 CDD:409353 2/5 (40%)
Ig_3 134..208 CDD:404760 25/87 (29%)
Ig strand B 153..157 CDD:409353 1/3 (33%)
Ig strand C 166..170 CDD:409353 1/3 (33%)
Ig strand E 187..191 CDD:409353 0/3 (0%)
Ig strand F 201..206 CDD:409353 3/4 (75%)
Ig strand G 215..218 CDD:409353 0/2 (0%)
Ig 227..318 CDD:416386 27/107 (25%)
Ig strand C 256..260 CDD:409353 0/4 (0%)
Ig strand E 286..290 CDD:409353 3/3 (100%)
Ig strand F 300..305 CDD:409353 2/4 (50%)
rstNP_001284835.1 IG_like 34..130 CDD:214653
Ig 42..114 CDD:299845
C2-set_2 135..225 CDD:285423
Ig_3 265..329 CDD:290638 21/65 (32%)
I-set 346..420 CDD:254352 25/90 (28%)
Ig 360..425 CDD:299845 23/81 (28%)
Ig5_KIRREL3-like 428..524 CDD:143235 24/96 (25%)
IG_like 435..524 CDD:214653 22/89 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.