| Sequence 1: | NP_523713.2 | Gene: | Lac / 36363 | FlyBaseID: | FBgn0010238 | Length: | 359 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_006232737.1 | Gene: | Kirrel1 / 310695 | RGDID: | 727883 | Length: | 805 | Species: | Rattus norvegicus |
| Alignment Length: | 377 | Identity: | 88/377 - (23%) |
|---|---|---|---|
| Similarity: | 134/377 - (35%) | Gaps: | 88/377 - (23%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 12 STLLLAIFVQQTLAQRTPTISYITQEQIKDIGGTVEFDCSVQYAKEYNVLFLKTDSDPVFLSTGS 76
Fly 77 TLVIKDSRFSLRYDPNSSTYKLQIKDIQETDAGTYTCQVVISTVHKVSAEVKLSVRRPPVISDNS 141
Fly 142 TQSVVASEGSEVQMECYASGYPTP-TITWRRENN----------AILPTDSATYVGNTLRIKSVK 195
Fly 196 KEDRGTYY-CVADNGVS---------------------------------------------KGD 214
Fly 215 RRNINVEVEFAPVITVPRPRLGQALQYDMDLECHIEAYPPPAIVWT--KDDIQLANNQHYSISHF 277
Fly 278 ATADEY-----TDSTLRVITVEKRQ------YGDYVCKATNRF-GEAEARVN 317 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Lac | NP_523713.2 | IG_like | 36..131 | CDD:214653 | 24/94 (26%) |
| FR1 | 37..50 | CDD:409353 | 4/12 (33%) | ||
| Ig strand A' | 37..42 | CDD:409353 | 0/4 (0%) | ||
| Ig strand B | 44..51 | CDD:409353 | 1/6 (17%) | ||
| CDR1 | 51..59 | CDD:409353 | 0/7 (0%) | ||
| Ig strand C | 59..63 | CDD:409353 | 0/3 (0%) | ||
| FR2 | 60..63 | CDD:409353 | 0/2 (0%) | ||
| CDR2 | 67..81 | CDD:409353 | 3/13 (23%) | ||
| Ig strand C' | 68..72 | CDD:409353 | 0/3 (0%) | ||
| Ig strand C' | 79..81 | CDD:409353 | 0/1 (0%) | ||
| FR3 | 84..115 | CDD:409353 | 11/30 (37%) | ||
| Ig strand D | 84..90 | CDD:409353 | 1/5 (20%) | ||
| Ig strand E | 94..102 | CDD:409353 | 1/7 (14%) | ||
| Ig strand F | 108..115 | CDD:409353 | 6/6 (100%) | ||
| CDR3 | 116..124 | CDD:409353 | 0/7 (0%) | ||
| FR4 | 124..130 | CDD:409353 | 2/5 (40%) | ||
| Ig strand G | 124..130 | CDD:409353 | 2/5 (40%) | ||
| Ig_3 | 134..208 | CDD:404760 | 27/85 (32%) | ||
| Ig strand B | 153..157 | CDD:409353 | 1/3 (33%) | ||
| Ig strand C | 166..170 | CDD:409353 | 1/3 (33%) | ||
| Ig strand E | 187..191 | CDD:409353 | 2/3 (67%) | ||
| Ig strand F | 201..206 | CDD:409353 | 3/5 (60%) | ||
| Ig strand G | 215..218 | CDD:409353 | 1/2 (50%) | ||
| Ig | 227..318 | CDD:416386 | 26/105 (25%) | ||
| Ig strand C | 256..260 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 286..290 | CDD:409353 | 0/3 (0%) | ||
| Ig strand F | 300..305 | CDD:409353 | 2/4 (50%) | ||
| Kirrel1 | XP_006232737.1 | I-set | 54..148 | CDD:254352 | |
| Ig | 57..148 | CDD:299845 | |||
| Ig2_KIRREL3-like | 170..251 | CDD:143236 | |||
| I-set | 255..336 | CDD:254352 | 3/4 (75%) | ||
| Ig_2 | 259..337 | CDD:290606 | 3/5 (60%) | ||
| Ig_2 | 340..437 | CDD:290606 | 26/109 (24%) | ||
| IG_like | 346..437 | CDD:214653 | 26/103 (25%) | ||
| Ig5_KIRREL3 | 439..536 | CDD:143306 | 28/98 (29%) | ||
| IG_like | 451..536 | CDD:214653 | 23/86 (27%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.900 | |||||