| Sequence 1: | NP_523713.2 | Gene: | Lac / 36363 | FlyBaseID: | FBgn0010238 | Length: | 359 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001284756.1 | Gene: | sdk / 31017 | FlyBaseID: | FBgn0021764 | Length: | 2265 | Species: | Drosophila melanogaster |
| Alignment Length: | 387 | Identity: | 95/387 - (24%) |
|---|---|---|---|
| Similarity: | 140/387 - (36%) | Gaps: | 97/387 - (25%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 29 PTISYITQEQIKDIG-GTVEFDC--SVQYAKEYNVLFLKTDSDPVFLSTGSTLVIKDSRFSLRYD 90
Fly 91 PNSSTYKLQIKDIQETDAGTYTCQVVIST--VHKVSAEVKLSVRRPPVISDNSTQSVVASEGSEV 153
Fly 154 QMECYASGYPTPTITWRRENNAI-LPTDSATY---VGNTLRIKSVKKEDRGTYYCVADN------ 208
Fly 209 ----------------------------------GVSKG------DRRNINVEVEF--APVITVP 231
Fly 232 RPRLGQALQ-YDMDLECHIEAYPPPAIVWTKDDIQLANNQHYSISHFATADEYTDSTLRVITVEK 295
Fly 296 RQYGDYVCKATNRFG--EAEARVNLFETIIPVCPPACGQAYIAGAEDVSATSFALVGILAAL 355 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Lac | NP_523713.2 | IG_like | 36..131 | CDD:214653 | 28/99 (28%) |
| FR1 | 37..50 | CDD:409353 | 4/13 (31%) | ||
| Ig strand A' | 37..42 | CDD:409353 | 0/4 (0%) | ||
| Ig strand B | 44..51 | CDD:409353 | 4/8 (50%) | ||
| CDR1 | 51..59 | CDD:409353 | 1/7 (14%) | ||
| Ig strand C | 59..63 | CDD:409353 | 1/3 (33%) | ||
| FR2 | 60..63 | CDD:409353 | 1/2 (50%) | ||
| CDR2 | 67..81 | CDD:409353 | 2/13 (15%) | ||
| Ig strand C' | 68..72 | CDD:409353 | 1/3 (33%) | ||
| Ig strand C' | 79..81 | CDD:409353 | 0/1 (0%) | ||
| FR3 | 84..115 | CDD:409353 | 10/30 (33%) | ||
| Ig strand D | 84..90 | CDD:409353 | 2/5 (40%) | ||
| Ig strand E | 94..102 | CDD:409353 | 2/7 (29%) | ||
| Ig strand F | 108..115 | CDD:409353 | 4/6 (67%) | ||
| CDR3 | 116..124 | CDD:409353 | 0/9 (0%) | ||
| FR4 | 124..130 | CDD:409353 | 2/5 (40%) | ||
| Ig strand G | 124..130 | CDD:409353 | 2/5 (40%) | ||
| Ig_3 | 134..208 | CDD:404760 | 22/77 (29%) | ||
| Ig strand B | 153..157 | CDD:409353 | 2/3 (67%) | ||
| Ig strand C | 166..170 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 187..191 | CDD:409353 | 3/3 (100%) | ||
| Ig strand F | 201..206 | CDD:409353 | 1/4 (25%) | ||
| Ig strand G | 215..218 | CDD:409353 | 2/2 (100%) | ||
| Ig | 227..318 | CDD:416386 | 24/93 (26%) | ||
| Ig strand C | 256..260 | CDD:409353 | 1/3 (33%) | ||
| Ig strand E | 286..290 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 300..305 | CDD:409353 | 2/4 (50%) | ||
| sdk | NP_001284756.1 | Ig | 71..157 | CDD:299845 | |
| I-set | 72..150 | CDD:254352 | |||
| Ig | 172..245 | CDD:299845 | |||
| IG_like | 280..356 | CDD:214653 | 24/87 (28%) | ||
| Ig | 280..343 | CDD:299845 | 20/74 (27%) | ||
| IG_like | 375..450 | CDD:214653 | 21/74 (28%) | ||
| Ig | 378..447 | CDD:143165 | 20/68 (29%) | ||
| Ig | 506..587 | CDD:299845 | 23/87 (26%) | ||
| IG_like | 506..587 | CDD:214653 | 23/87 (26%) | ||
| I-set | 592..682 | CDD:254352 | 8/33 (24%) | ||
| Ig | 595..682 | CDD:299845 | 8/30 (27%) | ||
| FN3 | 686..789 | CDD:238020 | |||
| FN3 | 798..893 | CDD:238020 | |||
| FN3 | 901..1005 | CDD:238020 | |||
| fn3 | 1011..1094 | CDD:278470 | |||
| FN3 | 1108..1202 | CDD:238020 | |||
| FN3 | 1210..1308 | CDD:238020 | |||
| fn3 | 1317..1402 | CDD:278470 | |||
| FN3 | 1415..1507 | CDD:238020 | |||
| FN3 | 1513..1608 | CDD:238020 | |||
| fn3 | 1617..1708 | CDD:278470 | |||
| FN3 | 1722..1823 | CDD:238020 | |||
| FN3 | 1828..1920 | CDD:238020 | |||
| FN3 | 1927..2016 | CDD:238020 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||