| Sequence 1: | NP_523713.2 | Gene: | Lac / 36363 | FlyBaseID: | FBgn0010238 | Length: | 359 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_218634.5 | Gene: | Iglon5 / 308557 | RGDID: | 1305344 | Length: | 336 | Species: | Rattus norvegicus |
| Alignment Length: | 317 | Identity: | 93/317 - (29%) |
|---|---|---|---|
| Similarity: | 126/317 - (39%) | Gaps: | 57/317 - (17%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 20 VQQTLAQRTPTISYITQEQIKDIGGTVEFDC-------SVQYAKEYNVLFLKTD---SDP---VF 71
Fly 72 LSTGSTLVIKDSRFSLRYDPNSSTYKLQIKDIQETDAGTYTCQVVISTVHK-VSAEVKLSVRRPP 135
Fly 136 VISDNSTQSVVASEGSEVQMECYASGYPTPTITWRRENNAILPTDSATYVGNTLRIKSVKKEDRG 200
Fly 201 TYYCVADNGV-SKGDRRNINVEVEFAPVI---TVPRPRLGQALQYDMDLECHIEAYPPPAIVWTK 261
Fly 262 DDIQLANNQHYSISHFATADEYTDSTLRVITVEKRQYGDYVCKATNRFGEAEARVNL 318 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Lac | NP_523713.2 | IG_like | 36..131 | CDD:214653 | 21/108 (19%) |
| FR1 | 37..50 | CDD:409353 | 2/12 (17%) | ||
| Ig strand A' | 37..42 | CDD:409353 | 1/4 (25%) | ||
| Ig strand B | 44..51 | CDD:409353 | 1/13 (8%) | ||
| CDR1 | 51..59 | CDD:409353 | 1/7 (14%) | ||
| Ig strand C | 59..63 | CDD:409353 | 2/3 (67%) | ||
| FR2 | 60..63 | CDD:409353 | 1/2 (50%) | ||
| CDR2 | 67..81 | CDD:409353 | 4/16 (25%) | ||
| Ig strand C' | 68..72 | CDD:409353 | 2/6 (33%) | ||
| Ig strand C' | 79..81 | CDD:409353 | 0/1 (0%) | ||
| FR3 | 84..115 | CDD:409353 | 6/30 (20%) | ||
| Ig strand D | 84..90 | CDD:409353 | 0/5 (0%) | ||
| Ig strand E | 94..102 | CDD:409353 | 1/7 (14%) | ||
| Ig strand F | 108..115 | CDD:409353 | 4/6 (67%) | ||
| CDR3 | 116..124 | CDD:409353 | 2/8 (25%) | ||
| FR4 | 124..130 | CDD:409353 | 1/5 (20%) | ||
| Ig strand G | 124..130 | CDD:409353 | 1/5 (20%) | ||
| Ig_3 | 134..208 | CDD:404760 | 25/73 (34%) | ||
| Ig strand B | 153..157 | CDD:409353 | 1/3 (33%) | ||
| Ig strand C | 166..170 | CDD:409353 | 2/3 (67%) | ||
| Ig strand E | 187..191 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 201..206 | CDD:409353 | 2/4 (50%) | ||
| Ig strand G | 215..218 | CDD:409353 | 1/2 (50%) | ||
| Ig | 227..318 | CDD:416386 | 32/93 (34%) | ||
| Ig strand C | 256..260 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 286..290 | CDD:409353 | 2/3 (67%) | ||
| Ig strand F | 300..305 | CDD:409353 | 2/4 (50%) | ||
| Iglon5 | XP_218634.5 | Ig | 41..129 | CDD:416386 | 22/112 (20%) |
| Ig strand A' | 41..46 | CDD:409353 | 1/4 (25%) | ||
| Ig strand B | 48..56 | CDD:409353 | 1/7 (14%) | ||
| CDR1 | 56..60 | CDD:409353 | 0/3 (0%) | ||
| FR2 | 61..68 | CDD:409353 | 1/6 (17%) | ||
| Ig strand C | 61..67 | CDD:409353 | 1/5 (20%) | ||
| CDR2 | 69..79 | CDD:409353 | 3/9 (33%) | ||
| Ig strand C' | 71..74 | CDD:409353 | 1/2 (50%) | ||
| Ig strand C' | 76..79 | CDD:409353 | 1/2 (50%) | ||
| FR3 | 80..115 | CDD:409353 | 10/54 (19%) | ||
| Ig strand D | 84..91 | CDD:409353 | 0/6 (0%) | ||
| Ig strand E | 94..100 | CDD:409353 | 0/5 (0%) | ||
| Ig strand F | 107..115 | CDD:409353 | 4/9 (44%) | ||
| CDR3 | 116..120 | CDD:409353 | 2/3 (67%) | ||
| Ig strand G | 120..129 | CDD:409353 | 2/8 (25%) | ||
| FR4 | 122..129 | CDD:409353 | 2/6 (33%) | ||
| Ig strand A | 132..137 | CDD:409353 | 2/5 (40%) | ||
| Ig_3 | 134..199 | CDD:404760 | 24/71 (34%) | ||
| Ig strand A' | 140..145 | CDD:409353 | 1/4 (25%) | ||
| Ig strand B | 148..157 | CDD:409353 | 2/8 (25%) | ||
| Ig strand C | 163..167 | CDD:409353 | 2/3 (67%) | ||
| Ig strand D | 174..177 | CDD:409353 | 1/2 (50%) | ||
| Ig strand E | 178..183 | CDD:409353 | 1/4 (25%) | ||
| Ig strand F | 191..199 | CDD:409353 | 4/7 (57%) | ||
| Ig_3 | 217..295 | CDD:404760 | 29/84 (35%) | ||
| putative Ig strand A | 218..224 | CDD:409353 | 2/5 (40%) | ||
| Ig strand B | 234..238 | CDD:409353 | 1/7 (14%) | ||
| Ig strand C | 247..251 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 274..278 | CDD:409353 | 2/3 (67%) | ||
| Ig strand F | 288..293 | CDD:409353 | 2/4 (50%) | ||
| Ig strand G | 301..304 | CDD:409353 | 1/2 (50%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C166337177 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D265311at33208 | |
| OrthoFinder | 1 | 1.000 | - | - | FOG0000150 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 1 | 1.000 | - | - | X97 | |
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 7 | 6.750 | |||||