DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lac and ncam1a

DIOPT Version :9

Sequence 1:NP_523713.2 Gene:Lac / 36363 FlyBaseID:FBgn0010238 Length:359 Species:Drosophila melanogaster
Sequence 2:XP_009293555.1 Gene:ncam1a / 30447 ZFINID:ZDB-GENE-990415-31 Length:1010 Species:Danio rerio


Alignment Length:354 Identity:95/354 - (26%)
Similarity:146/354 - (41%) Gaps:72/354 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 PTI--SYITQEQIKDIGGTVEFDCSVQYAKEYNVLFLKTDSDPVFLSTGSTLVIKDSRFSLRYDP 91
            |:|  .|.......||...|...|......|..|.:.:          |:|.:..|.::||..|.
Zfish   209 PSIRTRYTELNATADINQAVTLACHADGYPEPTVKWAR----------GNTELESDEKYSLNEDG 263

  Fly    92 NSSTYKLQIKDIQETDAGTYTCQVVISTVHKVSAEVKLSVRRPPVIS--DNSTQSVVASEGSE-V 153
            :    :|.|||:.:.|.|.|.| :..:...:.|.||.|:|...|.|:  :|.|    |||..| :
Zfish   264 S----ELTIKDVNKLDEGDYKC-IARNKAGERSEEVTLNVFVQPKITFLENQT----ASELEEQI 319

  Fly   154 QMECYASGYPTPTITW---RR-------------------ENNAILPTDSATYVGNTLRIKSVKK 196
            .:.|.|:|.|||.|.|   ||                   :.|.::.:|:..   ::|.:|.|:.
Zfish   320 TLTCEATGDPTPNIIWSFGRRVFTENEQASWTRPEKHKSLDGNVVVRSDARV---SSLTLKYVQF 381

  Fly   197 EDRGTYYCVADNGVSKGDRRNINVEVEFAPVITVPRPRLGQAL----QYDMDLECHIEAYPPPAI 257
            .|.|.|.|.|.|.:.: |.:::.:||.:||.|..|     ||:    ....::.|...|:|..::
Zfish   382 TDAGQYLCTARNSIGQ-DIQSMYLEVRYAPKIQGP-----QAVFTWEGNPANITCEALAHPGASV 440

  Fly   258 VWTKDDIQL--ANNQHYSISHFATADEYTDSTLRVITVEKRQYGDYVCKATNRFGEAEARVNLFE 320
            :|.:|..||  ||..:..|.:..|.     |.|.|....:..:|.|.|.|||..|.......|.:
Zfish   441 LWFRDGQQLPSANTTNVKIYNTPTV-----SFLEVTPDSQNDFGSYNCTATNVIGTESKEFILVQ 500

  Fly   321 TIIPVCP------PACGQAYIAGAEDVSA 343
            ..:|..|      |....|.|...|..|:
Zfish   501 ADVPSAPSIERVEPYSSTAMIEFEEPASS 529

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LacNP_523713.2 IG_like 36..131 CDD:214653 24/94 (26%)
FR1 37..50 CDD:409353 3/12 (25%)
Ig strand A' 37..42 CDD:409353 0/4 (0%)
Ig strand B 44..51 CDD:409353 1/6 (17%)
CDR1 51..59 CDD:409353 1/7 (14%)
Ig strand C 59..63 CDD:409353 1/3 (33%)
FR2 60..63 CDD:409353 1/2 (50%)
CDR2 67..81 CDD:409353 2/13 (15%)
Ig strand C' 68..72 CDD:409353 0/3 (0%)
Ig strand C' 79..81 CDD:409353 0/1 (0%)
FR3 84..115 CDD:409353 11/30 (37%)
Ig strand D 84..90 CDD:409353 2/5 (40%)
Ig strand E 94..102 CDD:409353 2/7 (29%)
Ig strand F 108..115 CDD:409353 3/6 (50%)
CDR3 116..124 CDD:409353 0/7 (0%)
FR4 124..130 CDD:409353 3/5 (60%)
Ig strand G 124..130 CDD:409353 3/5 (60%)
Ig_3 134..208 CDD:404760 28/98 (29%)
Ig strand B 153..157 CDD:409353 0/3 (0%)
Ig strand C 166..170 CDD:409353 2/6 (33%)
Ig strand E 187..191 CDD:409353 1/3 (33%)
Ig strand F 201..206 CDD:409353 2/4 (50%)
Ig strand G 215..218 CDD:409353 0/2 (0%)
Ig 227..318 CDD:416386 25/96 (26%)
Ig strand C 256..260 CDD:409353 0/3 (0%)
Ig strand E 286..290 CDD:409353 2/3 (67%)
Ig strand F 300..305 CDD:409353 2/4 (50%)
ncam1aXP_009293555.1 Ig 20..112 CDD:299845
I-set 21..111 CDD:254352
IG_like 121..200 CDD:214653
IGc2 128..189 CDD:197706
Ig 208..301 CDD:299845 28/106 (26%)
IG_like 219..298 CDD:214653 24/93 (26%)
Ig 300..406 CDD:299845 30/113 (27%)
IG_like 308..406 CDD:214653 28/105 (27%)
ig 413..498 CDD:278476 24/94 (26%)
IG_like 415..498 CDD:214653 24/92 (26%)
fn3 505..589 CDD:278470 6/25 (24%)
FN3 624..715 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.