| Sequence 1: | NP_523713.2 | Gene: | Lac / 36363 | FlyBaseID: | FBgn0010238 | Length: | 359 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_981954.2 | Gene: | Ncam2 / 288280 | RGDID: | 1303131 | Length: | 837 | Species: | Rattus norvegicus |
| Alignment Length: | 327 | Identity: | 84/327 - (25%) |
|---|---|---|---|
| Similarity: | 133/327 - (40%) | Gaps: | 56/327 - (17%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 12 STLLLAIFVQ--QTLAQRTPTISYITQEQIKDIGGTVEFDCSVQYAKE----YNVLFLKTDSDPV 70
Fly 71 FLSTGSTLVIKDSRFSLRYDPNSSTYKLQIKDIQETDAGTYTCQVVISTVHKVSAEV------KL 129
Fly 130 SVRRPPVISDNSTQSVVASEGSEVQMECYASGYPTPTITWRRENNAI--LPTDS-ATYVGNTLRI 191
Fly 192 KSVKKEDRGTYYC---VADNGVSKGDRRNINVEVEFAPVITVPRPRLGQALQ--YDMDLECHIEA 251
Fly 252 YPPPAIVWTKDDIQLANNQHYSISHFATADEYTDSTLRVITVEKRQYGDYVCKATNRFGEAEARV 316
Fly 317 NL 318 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Lac | NP_523713.2 | IG_like | 36..131 | CDD:214653 | 22/104 (21%) |
| FR1 | 37..50 | CDD:409353 | 2/12 (17%) | ||
| Ig strand A' | 37..42 | CDD:409353 | 0/4 (0%) | ||
| Ig strand B | 44..51 | CDD:409353 | 1/6 (17%) | ||
| CDR1 | 51..59 | CDD:409353 | 1/11 (9%) | ||
| Ig strand C | 59..63 | CDD:409353 | 1/3 (33%) | ||
| FR2 | 60..63 | CDD:409353 | 0/2 (0%) | ||
| CDR2 | 67..81 | CDD:409353 | 2/13 (15%) | ||
| Ig strand C' | 68..72 | CDD:409353 | 0/3 (0%) | ||
| Ig strand C' | 79..81 | CDD:409353 | 0/1 (0%) | ||
| FR3 | 84..115 | CDD:409353 | 8/30 (27%) | ||
| Ig strand D | 84..90 | CDD:409353 | 1/5 (20%) | ||
| Ig strand E | 94..102 | CDD:409353 | 2/7 (29%) | ||
| Ig strand F | 108..115 | CDD:409353 | 4/6 (67%) | ||
| CDR3 | 116..124 | CDD:409353 | 0/7 (0%) | ||
| FR4 | 124..130 | CDD:409353 | 3/11 (27%) | ||
| Ig strand G | 124..130 | CDD:409353 | 3/11 (27%) | ||
| Ig_3 | 134..208 | CDD:404760 | 20/79 (25%) | ||
| Ig strand B | 153..157 | CDD:409353 | 0/3 (0%) | ||
| Ig strand C | 166..170 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 187..191 | CDD:409353 | 2/3 (67%) | ||
| Ig strand F | 201..206 | CDD:409353 | 2/7 (29%) | ||
| Ig strand G | 215..218 | CDD:409353 | 1/2 (50%) | ||
| Ig | 227..318 | CDD:416386 | 24/92 (26%) | ||
| Ig strand C | 256..260 | CDD:409353 | 2/3 (67%) | ||
| Ig strand E | 286..290 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 300..305 | CDD:409353 | 3/4 (75%) | ||
| Ncam2 | NP_981954.2 | IgI_1_NCAM-2 | 21..113 | CDD:409452 | 23/111 (21%) |
| Ig strand B | 38..42 | CDD:409452 | 1/3 (33%) | ||
| Ig strand C | 50..54 | CDD:409452 | 0/3 (0%) | ||
| Ig strand E | 76..80 | CDD:409452 | 2/13 (15%) | ||
| Ig strand F | 90..95 | CDD:409452 | 2/4 (50%) | ||
| Ig strand G | 104..107 | CDD:409452 | 1/2 (50%) | ||
| IGc2 | 128..189 | CDD:197706 | 17/60 (28%) | ||
| Ig strand B | 130..139 | CDD:409353 | 1/8 (13%) | ||
| Ig strand C | 145..153 | CDD:409353 | 1/7 (14%) | ||
| Ig strand C' | 156..159 | CDD:409353 | 0/2 (0%) | ||
| Ig strand D | 162..167 | CDD:409353 | 1/4 (25%) | ||
| Ig strand E | 168..175 | CDD:409353 | 3/6 (50%) | ||
| IgI_1_MuSK | 209..298 | CDD:409562 | 26/95 (27%) | ||
| Ig strand B | 228..232 | CDD:409562 | 2/3 (67%) | ||
| Ig strand C | 241..245 | CDD:409562 | 2/3 (67%) | ||
| Ig strand E | 264..268 | CDD:409562 | 1/3 (33%) | ||
| Ig strand F | 278..283 | CDD:409562 | 3/4 (75%) | ||
| Ig strand G | 291..294 | CDD:409562 | 0/2 (0%) | ||
| Ig | 300..397 | CDD:416386 | |||
| Ig strand A | 300..305 | CDD:409353 | |||
| Ig strand A' | 309..313 | CDD:409353 | |||
| Ig strand B | 317..325 | CDD:409353 | |||
| Ig strand C | 331..337 | CDD:409353 | |||
| Ig strand C' | 340..343 | CDD:409353 | |||
| Ig strand D | 353..359 | CDD:409353 | |||
| Ig strand E | 362..368 | CDD:409353 | |||
| Ig strand F | 376..384 | CDD:409353 | |||
| Ig strand G | 387..397 | CDD:409353 | |||
| Ig_3 | 401..479 | CDD:404760 | |||
| Ig strand B | 418..422 | CDD:409353 | |||
| Ig strand C | 431..435 | CDD:409353 | |||
| Ig strand E | 458..462 | CDD:409353 | |||
| Ig strand F | 472..477 | CDD:409353 | |||
| Ig strand G | 486..489 | CDD:409353 | |||
| FN3 | 496..588 | CDD:238020 | |||
| fn3 | 594..678 | CDD:394996 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR12231 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 2.000 | |||||