DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lac and Dscam4

DIOPT Version :9

Sequence 1:NP_523713.2 Gene:Lac / 36363 FlyBaseID:FBgn0010238 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001261571.1 Gene:Dscam4 / 2769008 FlyBaseID:FBgn0263219 Length:1935 Species:Drosophila melanogaster


Alignment Length:323 Identity:82/323 - (25%)
Similarity:136/323 - (42%) Gaps:50/323 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 VQQTLAQRTPTISYI-TQEQIKDIGGTVEFDCSVQYAKEYNVLFLKTDSDPVFLSTGSTLVIKDS 83
            :|.:|....|..::: .|.|..|:....:|.|.|.....::|.:|. |..|         :::|:
  Fly   320 IQVSLTVTAPLTAHLQPQVQTVDVDKDAQFQCIVSGHPVHDVNWLH-DGKP---------ILRDN 374

  Fly    84 RFSLRYDPNSSTYKLQIKDIQETDAGTYTCQV------VISTVHKVSAEVKLSVRRPPVISDNST 142
            |..:..||.    :|.||.:|:.|.|.|.|.|      :.||     ||::|....|.::...|.
  Fly   375 RVEILTDPP----RLIIKKVQKEDPGMYQCFVSNEWEQIQST-----AELQLGDASPELLYWFSE 430

  Fly   143 QSVVASEGSEVQMECYASGYPTPTITWRRENNAILPTDSATYVG----------NTLRIKSVKKE 197
            |::  ..|..|.::|.|:|.|.|..||..:...| |..|...||          :.:.|.:||:|
  Fly   431 QTL--QPGPTVSLKCVATGNPLPQFTWSLDGFPI-PDSSRFLVGQYVTIHDDVISHVNISNVKEE 492

  Fly   198 DRGTYYCVADNGVSKGDRRNINVEVEFAPVITVPRPRLGQALQYDMDLECHIEAYPPPAIVWTKD 262
            |.|.|.|.|.|.:.|.. .:..|.:...|.|. ..|::......|:.::|.:..||...|.|.:|
  Fly   493 DGGEYTCTAQNAIGKVS-HSAKVNIYGLPYIR-EMPKITGISGSDLIVKCPVAGYPIDKIHWERD 555

  Fly   263 DIQLANNQHYSISHFATADEYTDSTLRVITVEK-RQYGDYVCKATNRFGEAEARVNLFETIIP 324
            ...|..|:...        .|.:.||.:..::: ...|.|.|.|.|:..:...|....:.::|
  Fly   556 GQTLPINRRQR--------AYNNGTLIIEQLQRLEDAGTYTCMAQNKQKQTSRRNVEIQVLVP 610

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LacNP_523713.2 IG_like 36..131 CDD:214653 28/100 (28%)
FR1 37..50 CDD:409353 3/12 (25%)
Ig strand A' 37..42 CDD:409353 1/4 (25%)
Ig strand B 44..51 CDD:409353 1/6 (17%)
CDR1 51..59 CDD:409353 1/7 (14%)
Ig strand C 59..63 CDD:409353 1/3 (33%)
FR2 60..63 CDD:409353 1/2 (50%)
CDR2 67..81 CDD:409353 1/13 (8%)
Ig strand C' 68..72 CDD:409353 1/3 (33%)
Ig strand C' 79..81 CDD:409353 0/1 (0%)
FR3 84..115 CDD:409353 11/30 (37%)
Ig strand D 84..90 CDD:409353 1/5 (20%)
Ig strand E 94..102 CDD:409353 2/7 (29%)
Ig strand F 108..115 CDD:409353 3/6 (50%)
CDR3 116..124 CDD:409353 2/7 (29%)
FR4 124..130 CDD:409353 2/5 (40%)
Ig strand G 124..130 CDD:409353 2/5 (40%)
Ig_3 134..208 CDD:404760 26/83 (31%)
Ig strand B 153..157 CDD:409353 1/3 (33%)
Ig strand C 166..170 CDD:409353 1/3 (33%)
Ig strand E 187..191 CDD:409353 0/3 (0%)
Ig strand F 201..206 CDD:409353 2/4 (50%)
Ig strand G 215..218 CDD:409353 0/2 (0%)
Ig 227..318 CDD:416386 20/91 (22%)
Ig strand C 256..260 CDD:409353 1/3 (33%)
Ig strand E 286..290 CDD:409353 2/3 (67%)
Ig strand F 300..305 CDD:409353 2/4 (50%)
Dscam4NP_001261571.1 Ig 31..124 CDD:416386
Ig strand A 32..35 CDD:409353
Ig strand A' 41..45 CDD:409353
Ig strand B 48..57 CDD:409353
Ig strand D 75..78 CDD:409353
Ig strand E 83..88 CDD:409353
Ig strand F 101..109 CDD:409353
Ig strand G 112..124 CDD:409353
Ig 235..326 CDD:416386 2/5 (40%)
Ig strand A 235..238 CDD:409353
Ig strand A' 244..248 CDD:409353
Ig strand B 251..258 CDD:409353
Ig strand C 266..271 CDD:409353
Ig strand C' 276..279 CDD:409353
Ig strand D 285..289 CDD:409353
Ig strand E 292..298 CDD:409353
Ig strand F 305..313 CDD:409353
Ig strand G 316..326 CDD:409353 2/5 (40%)
IgC2_3_Dscam 329..417 CDD:409549 28/106 (26%)
Ig strand B 347..351 CDD:409549 1/3 (33%)
Ig strand C 360..364 CDD:409549 1/3 (33%)
Ig strand E 383..387 CDD:409549 1/7 (14%)
Ig strand F 397..402 CDD:409549 2/4 (50%)
Ig strand G 410..413 CDD:409549 2/7 (29%)
IgI_4_Dscam 422..516 CDD:409548 29/97 (30%)
Ig strand B 439..443 CDD:409548 1/3 (33%)
Ig strand C 452..456 CDD:409548 1/3 (33%)
Ig strand E 482..486 CDD:409548 0/3 (0%)
Ig strand F 496..501 CDD:409548 2/4 (50%)
Ig strand G 509..512 CDD:409548 0/3 (0%)
IgI_5_Dscam 520..607 CDD:409550 21/95 (22%)
Ig strand B 536..540 CDD:409550 0/3 (0%)
Ig strand C 549..553 CDD:409550 1/3 (33%)
Ig strand E 571..575 CDD:409550 2/3 (67%)
Ig strand F 586..591 CDD:409550 2/4 (50%)
Ig strand G 600..603 CDD:409550 1/2 (50%)
Ig 610..703 CDD:416386 1/1 (100%)
Ig strand A 611..613 CDD:409353 82/323 (25%)
Ig strand A' 620..624 CDD:409353
Ig strand B 627..636 CDD:409353
Ig strand C 641..648 CDD:409353
Ig strand C' 650..652 CDD:409353
Ig strand D 659..664 CDD:409353
Ig strand E 668..675 CDD:409353
Ig strand F 682..690 CDD:409353
Ig strand G 693..702 CDD:409353
IgI_7_Dscam 706..801 CDD:409546
Ig strand B 724..728 CDD:409546
Ig strand C 737..741 CDD:409546
Ig strand E 766..770 CDD:409546
Ig strand F 780..785 CDD:409546
Ig strand G 794..797 CDD:409546
Ig 818..904 CDD:416386
putative Ig strand B 820..827 CDD:409353
putative Ig strand C 835..841 CDD:409353
putative Ig strand C' 853..856 CDD:409353
putative Ig strand D 862..866 CDD:409353
putative Ig strand E 868..874 CDD:409353
putative Ig strand F 881..889 CDD:409353
putative Ig strand G 892..902 CDD:409353
FN3 906..999 CDD:238020
FN3 1006..1110 CDD:238020
fn3 1117..1203 CDD:394996
FN3 1215..1307 CDD:238020
Ig <1334..1401 CDD:416386
Ig strand C 1345..1349 CDD:409353
Ig strand D 1363..1366 CDD:409353
Ig strand E 1367..1372 CDD:409353
Ig strand F 1380..1388 CDD:409353
Ig strand G 1394..1401 CDD:409353
FN3 1405..1494 CDD:238020
FN3 1499..1580 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.