DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lac and SIGLEC7

DIOPT Version :9

Sequence 1:NP_523713.2 Gene:Lac / 36363 FlyBaseID:FBgn0010238 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_055200.1 Gene:SIGLEC7 / 27036 HGNCID:10876 Length:467 Species:Homo sapiens


Alignment Length:377 Identity:79/377 - (20%)
Similarity:134/377 - (35%) Gaps:89/377 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 SYITQEQIKDIGGTVEFDCSVQYAKEYNVLFLKTDSDPV---FLSTGSTLVIK------------ 81
            |.:|.::    |..|...||..|..:     .:||||||   :...|:.:..|            
Human    32 SSVTVQE----GMCVHVRCSFSYPVD-----SQTDSDPVHGYWFRAGNDISWKAPVATNNPAWAV 87

  Fly    82 ----DSRFSLRYDPNSSTYKLQIKDIQETDAGTYTCQVVISTV------HKVSAEVKLSVRRPPV 136
                ..||.|..||.:....|.|:|.:.:|||.|..::....:      .::|..|.....||.:
Human    88 QEETRDRFHLLGDPQTKNCTLSIRDARMSDAGRYFFRMEKGNIKWNYKYDQLSVNVTALTHRPNI 152

  Fly   137 ISDNSTQSVVASEGSEVQMECYA-----SGYPTPTITWRRENNAILPTDSATYVGNTLRIKSVKK 196
            :...:.:|     |....:.|..     .|.| |.|:|.  ..::.|...:|...:.|.:....:
Human   153 LIPGTLES-----GCFQNLTCSVPWACEQGTP-PMISWM--GTSVSPLHPSTTRSSVLTLIPQPQ 209

  Fly   197 EDRGTYYC-VADNGVSKGDRRNINVEVEFAP---VITVPRPR----------------LGQALQY 241
            ....:..| |...|......|.|.:.|.:.|   .:||.:..                .||:|: 
Human   210 HHGTSLTCQVTLPGAGVTTNRTIQLNVSYPPQNLTVTVFQGEGTASTALGNSSSLSVLEGQSLR- 273

  Fly   242 DMDLECHIEAYPPPAIVWTKDDIQLANNQHYSISHFATADEYTDSTLRVITVEKRQYGDYVCKAT 306
               |.|.:::.||..:.||...:.|..:|.            ::..:..:.|.....|::.|:|.
Human   274 ---LVCAVDSNPPARLSWTWRSLTLYPSQP------------SNPLVLELQVHLGDEGEFTCRAQ 323

  Fly   307 NRFGEAEARVNL------FETIIPVCPPACGQAYIAGAEDVSATSFALVGIL 352
            |..|.....:||      ...:.||.....|....|||..:...||.::.|:
Human   324 NSLGSQHVSLNLSLQQEYTGKMRPVSGVLLGAVGGAGATALVFLSFCVIFIV 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LacNP_523713.2 IG_like 36..131 CDD:214653 27/119 (23%)
FR1 37..50 CDD:409353 2/12 (17%)
Ig strand A' 37..42 CDD:409353 0/4 (0%)
Ig strand B 44..51 CDD:409353 1/6 (17%)
CDR1 51..59 CDD:409353 2/7 (29%)
Ig strand C 59..63 CDD:409353 0/3 (0%)
FR2 60..63 CDD:409353 0/2 (0%)
CDR2 67..81 CDD:409353 5/16 (31%)
Ig strand C' 68..72 CDD:409353 3/6 (50%)
Ig strand C' 79..81 CDD:409353 0/1 (0%)
FR3 84..115 CDD:409353 12/30 (40%)
Ig strand D 84..90 CDD:409353 3/5 (60%)
Ig strand E 94..102 CDD:409353 2/7 (29%)
Ig strand F 108..115 CDD:409353 3/6 (50%)
CDR3 116..124 CDD:409353 0/13 (0%)
FR4 124..130 CDD:409353 2/5 (40%)
Ig strand G 124..130 CDD:409353 2/5 (40%)
Ig_3 134..208 CDD:404760 14/79 (18%)
Ig strand B 153..157 CDD:409353 0/3 (0%)
Ig strand C 166..170 CDD:409353 1/3 (33%)
Ig strand E 187..191 CDD:409353 1/3 (33%)
Ig strand F 201..206 CDD:409353 1/5 (20%)
Ig strand G 215..218 CDD:409353 1/2 (50%)
Ig 227..318 CDD:416386 19/106 (18%)
Ig strand C 256..260 CDD:409353 0/3 (0%)
Ig strand E 286..290 CDD:409353 0/3 (0%)
Ig strand F 300..305 CDD:409353 1/4 (25%)
SIGLEC7NP_055200.1 Ig_Siglec_N 26..144 CDD:143189 28/120 (23%)
Sialic acid binding. /evidence=ECO:0000269|PubMed:12438315, ECO:0000269|PubMed:16623661, ECO:0000269|PubMed:16895906 131..135 0/3 (0%)
Ig 150..223 CDD:325142 14/80 (18%)
IG_like 261..336 CDD:214653 18/90 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 401..431
ITIM motif 435..440
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 443..467
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.