DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lac and Lsamp

DIOPT Version :9

Sequence 1:NP_523713.2 Gene:Lac / 36363 FlyBaseID:FBgn0010238 Length:359 Species:Drosophila melanogaster
Sequence 2:XP_030104997.1 Gene:Lsamp / 268890 MGIID:1261760 Length:392 Species:Mus musculus


Alignment Length:407 Identity:113/407 - (27%)
Similarity:172/407 - (42%) Gaps:88/407 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VWST-LLLAIFVQQTLA--QRTP---TISYITQEQIKDIGGTVEFDCSVQYAKEYNVLFLKT--- 65
            ||.. ..|::|..|.||  .:.|   .:|.||      |.||.|  ...:.|||...|.:::   
Mouse     9 VWVLGFFLSLFSLQVLAFWNQPPAEVNLSPIT------IPGTEE--TMRKKAKEEEGLPVRSVDF 65

  Fly    66 --DSDPVFLSTGSTLVIK----------------------DSRFSLRYDP-------NSSTYKLQ 99
              .:|.:.:..|.|.:::                      ..::||  ||       ::..|.|:
Mouse    66 NRGTDNITVRQGDTAILRCVVEDKNSKVAWLNRSGIIFAGHDKWSL--DPRVELEKRHALEYSLR 128

  Fly   100 IKDIQETDAGTYTCQVVISTVHK-VSAEVKLSVRRPPVISDNSTQSVVASEGSEVQMECYASGYP 163
            |:.:...|.|:|||.|  .|.|: .:::|.|.|:.||.|| |.:..|..:|||.|.:.|.|:|.|
Mouse   129 IQKVDVYDEGSYTCSV--QTQHEPKTSQVYLIVQVPPKIS-NISSDVTVNEGSNVTLVCMANGRP 190

  Fly   164 TPTITWRRENNAILPTDSATYVGNT--LRIKSVKKEDRGTYYCVADNGVSKGDRRNINVEVEFAP 226
            .|.||||.     |......:.|..  |.|..:.:|..|.|.|.|.|.||..|.:.:.|.|.:.|
Mouse   191 EPVITWRH-----LTPLGREFEGEEEYLEILGITREQSGKYECKAANEVSSADVKQVKVTVNYPP 250

  Fly   227 VITVPRPR---LGQALQYDMDLECHIEAYPPPAIVWTKDDIQLANNQHYSISHFATADEYTDSTL 288
            .||..:..   .|:    ...|:|...|.|.|...|.:||.::  |....:...:|..:   |:|
Mouse   251 TITESKSNEATTGR----QASLKCEASAVPAPDFEWYRDDTRI--NSANGLEIKSTEGQ---SSL 306

  Fly   289 RVITVEKRQYGDYVCKATNRFGEAEARVNLFETIIPVCPPAC------------GQAYIAGAEDV 341
            .|..|.:..||:|.|.|.|:.|...|.:.||:.::|..|...            |...:.|..  
Mouse   307 TVTNVTEEHYGNYTCVAANKLGVTNASLVLFKRVLPTVPHPIQEIGTTVHFKPKGPGSVRGIN-- 369

  Fly   342 SATSFAL-VGILAALLF 357
            .:.|.|: :.:|||.||
Mouse   370 GSVSLAVPLWLLAASLF 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LacNP_523713.2 IG_like 36..131 CDD:214653 28/129 (22%)
FR1 37..50 CDD:409353 4/12 (33%)
Ig strand A' 37..42 CDD:409353 0/4 (0%)
Ig strand B 44..51 CDD:409353 3/6 (50%)
CDR1 51..59 CDD:409353 3/7 (43%)
Ig strand C 59..63 CDD:409353 1/3 (33%)
FR2 60..63 CDD:409353 1/2 (50%)
CDR2 67..81 CDD:409353 3/13 (23%)
Ig strand C' 68..72 CDD:409353 1/3 (33%)
Ig strand C' 79..81 CDD:409353 0/1 (0%)
FR3 84..115 CDD:409353 12/37 (32%)
Ig strand D 84..90 CDD:409353 2/5 (40%)
Ig strand E 94..102 CDD:409353 3/7 (43%)
Ig strand F 108..115 CDD:409353 4/6 (67%)
CDR3 116..124 CDD:409353 2/8 (25%)
FR4 124..130 CDD:409353 1/5 (20%)
Ig strand G 124..130 CDD:409353 1/5 (20%)
Ig_3 134..208 CDD:404760 28/75 (37%)
Ig strand B 153..157 CDD:409353 1/3 (33%)
Ig strand C 166..170 CDD:409353 2/3 (67%)
Ig strand E 187..191 CDD:409353 1/5 (20%)
Ig strand F 201..206 CDD:409353 2/4 (50%)
Ig strand G 215..218 CDD:409353 0/2 (0%)
Ig 227..318 CDD:416386 25/93 (27%)
Ig strand C 256..260 CDD:409353 0/3 (0%)
Ig strand E 286..290 CDD:409353 2/3 (67%)
Ig strand F 300..305 CDD:409353 2/4 (50%)
LsampXP_030104997.1 Ig 69..159 CDD:386229 20/93 (22%)
Ig_3 163..232 CDD:372822 27/74 (36%)
Ig_3 250..325 CDD:372822 23/83 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833574
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.