DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lac and NEGR1

DIOPT Version :9

Sequence 1:NP_523713.2 Gene:Lac / 36363 FlyBaseID:FBgn0010238 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_776169.2 Gene:NEGR1 / 257194 HGNCID:17302 Length:354 Species:Homo sapiens


Alignment Length:339 Identity:105/339 - (30%)
Similarity:155/339 - (45%) Gaps:59/339 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 GGTVEFDCSVQYAKEYNVLFLKTD------------SDPVFLSTGSTLVIKDSRFSLRYDP---- 91
            |.:|:|    .:|...|::..|.|            |...:|:..|.:.....::|:  ||    
Human    35 GQSVDF----PWAAVDNMMVRKGDTAVLRCYLEDGASKGAWLNRSSIIFAGGDKWSV--DPRVSI 93

  Fly    92 ---NSSTYKLQIKDIQETDAGTYTCQVVISTVHKV-SAEVKLSVRRPPVISDNSTQSVVASEGSE 152
               |...|.|||:::..||.|.|||.|  .|.|.. :.:|.|:|:.||.|.|.|....| :||:.
Human    94 STLNKRDYSLQIQNVDVTDDGPYTCSV--QTQHTPRTMQVHLTVQVPPKIYDISNDMTV-NEGTN 155

  Fly   153 VQMECYASGYPTPTITWRRENNAILPTDSATYVGNTLRIKSVKKEDRGTYYCVADNGVSKGDRRN 217
            |.:.|.|:|.|.|:|:||..:.:..|.::..|    |.|..:.::..|.|.|.|:|.||..|.|.
Human   156 VTLTCLATGKPEPSISWRHISPSAKPFENGQY----LDIYGITRDQAGEYECSAENDVSFPDVRK 216

  Fly   218 INVEVEFAPVI------TVPRPRLGQALQYDMDLECHIEAYPPPAIVWTKDDIQLANNQH-YSIS 275
            :.|.|.|||.|      ||...|.|.       :.|.....||||..|.|.:.:|.|.|. ..|.
Human   217 VKVVVNFAPTIQEIKSGTVTPGRSGL-------IRCEGAGVPPPAFEWYKGEKKLFNGQQGIIIQ 274

  Fly   276 HFATADEYTDSTLRVITVEKRQYGDYVCKATNRFGEAEARVNLFETIIPVCPPACGQAYIAGAED 340
            :|:|.     |.|.|..|.:..:|:|.|.|.|:.|...|.       :|:.||:..|..|.|:.|
Human   275 NFSTR-----SILTVTNVTQEHFGNYTCVAANKLGTTNAS-------LPLNPPSTAQYGITGSAD 327

  Fly   341 VSATSFALVGILAA 354
            |..:.:.||..|::
Human   328 VLFSCWYLVLTLSS 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LacNP_523713.2 IG_like 36..131 CDD:214653 29/107 (27%)
FR1 37..50 CDD:409353 3/6 (50%)
Ig strand A' 37..42 CDD:409353
Ig strand B 44..51 CDD:409353 2/6 (33%)
CDR1 51..59 CDD:409353 1/7 (14%)
Ig strand C 59..63 CDD:409353 1/3 (33%)
FR2 60..63 CDD:409353 0/2 (0%)
CDR2 67..81 CDD:409353 3/13 (23%)
Ig strand C' 68..72 CDD:409353 0/3 (0%)
Ig strand C' 79..81 CDD:409353 0/1 (0%)
FR3 84..115 CDD:409353 14/37 (38%)
Ig strand D 84..90 CDD:409353 1/5 (20%)
Ig strand E 94..102 CDD:409353 4/7 (57%)
Ig strand F 108..115 CDD:409353 4/6 (67%)
CDR3 116..124 CDD:409353 2/8 (25%)
FR4 124..130 CDD:409353 1/5 (20%)
Ig strand G 124..130 CDD:409353 1/5 (20%)
Ig_3 134..208 CDD:404760 25/73 (34%)
Ig strand B 153..157 CDD:409353 1/3 (33%)
Ig strand C 166..170 CDD:409353 1/3 (33%)
Ig strand E 187..191 CDD:409353 1/3 (33%)
Ig strand F 201..206 CDD:409353 2/4 (50%)
Ig strand G 215..218 CDD:409353 1/2 (50%)
Ig 227..318 CDD:416386 29/97 (30%)
Ig strand C 256..260 CDD:409353 1/3 (33%)
Ig strand E 286..290 CDD:409353 2/3 (67%)
Ig strand F 300..305 CDD:409353 2/4 (50%)
NEGR1NP_776169.2 IG 47..135 CDD:214652 25/91 (27%)
IGc2 152..210 CDD:197706 20/61 (33%)
Ig_3 225..301 CDD:372822 27/87 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143431
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H41447
Inparanoid 1 1.050 125 1.000 Inparanoid score I4716
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 1 1.000 - - otm40772
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6406
SonicParanoid 1 1.000 - - X97
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
109.830

Return to query results.
Submit another query.