| Sequence 1: | NP_523713.2 | Gene: | Lac / 36363 | FlyBaseID: | FBgn0010238 | Length: | 359 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_036010831.1 | Gene: | Cntn5 / 244682 | MGIID: | 3042287 | Length: | 1434 | Species: | Mus musculus |
| Alignment Length: | 366 | Identity: | 98/366 - (26%) |
|---|---|---|---|
| Similarity: | 144/366 - (39%) | Gaps: | 88/366 - (24%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 24 LAQRTPTISYITQEQIKDIGGTVEFDCSVQYA-------KEYNVLFLKTDS-----DP------- 69
Fly 70 --VFLSTGSTLVIKDSRFSL-------------RYDPNSSTYK-----LQIKDIQETDAGTYTCQ 114
Fly 115 VVISTVHKVSAEVKLSVRRPP--VISDNSTQSVVASEGSEVQMECYASGYPTPTITWRRENNAIL 177
Fly 178 PTDSATYVGNTLRIKSVKKEDRGTYYCVADNGVSKGDRRNINVEVEFAPVITVPRPRLGQ---AL 239
Fly 240 QYDMD----LECHIEAYPPPAIVWTKDDIQLANNQHYSISHFATADEYT---------------- 284
Fly 285 -------DSTLRVITVEKRQYGDYVCKATNRFGEAEARVNL 318 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Lac | NP_523713.2 | IG_like | 36..131 | CDD:214653 | 31/133 (23%) |
| FR1 | 37..50 | CDD:409353 | 3/12 (25%) | ||
| Ig strand A' | 37..42 | CDD:409353 | 1/4 (25%) | ||
| Ig strand B | 44..51 | CDD:409353 | 0/6 (0%) | ||
| CDR1 | 51..59 | CDD:409353 | 2/14 (14%) | ||
| Ig strand C | 59..63 | CDD:409353 | 1/3 (33%) | ||
| FR2 | 60..63 | CDD:409353 | 1/2 (50%) | ||
| CDR2 | 67..81 | CDD:409353 | 4/27 (15%) | ||
| Ig strand C' | 68..72 | CDD:409353 | 2/12 (17%) | ||
| Ig strand C' | 79..81 | CDD:409353 | 0/1 (0%) | ||
| FR3 | 84..115 | CDD:409353 | 13/48 (27%) | ||
| Ig strand D | 84..90 | CDD:409353 | 2/18 (11%) | ||
| Ig strand E | 94..102 | CDD:409353 | 3/12 (25%) | ||
| Ig strand F | 108..115 | CDD:409353 | 4/6 (67%) | ||
| CDR3 | 116..124 | CDD:409353 | 2/7 (29%) | ||
| FR4 | 124..130 | CDD:409353 | 1/5 (20%) | ||
| Ig strand G | 124..130 | CDD:409353 | 1/5 (20%) | ||
| Ig_3 | 134..208 | CDD:404760 | 28/75 (37%) | ||
| Ig strand B | 153..157 | CDD:409353 | 1/3 (33%) | ||
| Ig strand C | 166..170 | CDD:409353 | 1/3 (33%) | ||
| Ig strand E | 187..191 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 201..206 | CDD:409353 | 2/4 (50%) | ||
| Ig strand G | 215..218 | CDD:409353 | 0/2 (0%) | ||
| Ig | 227..318 | CDD:416386 | 31/120 (26%) | ||
| Ig strand C | 256..260 | CDD:409353 | 2/3 (67%) | ||
| Ig strand E | 286..290 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 300..305 | CDD:409353 | 2/4 (50%) | ||
| Cntn5 | XP_036010831.1 | Ig strand D | 741..745 | CDD:409353 | 0/3 (0%) |
| Ig strand E | 747..752 | CDD:409353 | 1/4 (25%) | ||
| Ig strand F | 761..768 | CDD:409353 | 3/6 (50%) | ||
| Ig strand G | 772..781 | CDD:409353 | 2/13 (15%) | ||
| Ig | 786..903 | CDD:416386 | 32/118 (27%) | ||
| Ig strand A | 786..791 | CDD:409353 | 1/4 (25%) | ||
| Ig strand A' | 794..799 | CDD:409353 | 0/4 (0%) | ||
| Ig strand B | 803..810 | CDD:409353 | 1/6 (17%) | ||
| Ig strand C | 818..822 | CDD:409353 | 2/3 (67%) | ||
| Ig strand D | 865..868 | CDD:409353 | 0/2 (0%) | ||
| Ig strand E | 869..874 | CDD:409353 | 2/4 (50%) | ||
| Ig strand F | 882..890 | CDD:409353 | 3/7 (43%) | ||
| Ig strand G | 896..903 | CDD:409353 | 2/6 (33%) | ||
| Ig | 905..1006 | CDD:416386 | |||
| Ig strand A | 905..911 | CDD:409353 | |||
| Ig strand A' | 914..919 | CDD:409353 | |||
| Ig strand B | 922..930 | CDD:409353 | |||
| Ig strand C | 939..943 | CDD:409353 | |||
| Ig strand D | 964..967 | CDD:409353 | |||
| Ig strand E | 968..972 | CDD:409353 | |||
| Ig strand F | 981..988 | CDD:409353 | |||
| Ig strand G | 995..999 | CDD:409353 | |||
| FN3 | 1006..1103 | CDD:238020 | |||
| FN3 | 1111..1203 | CDD:238020 | |||
| FN3 | 1213..1304 | CDD:238020 | |||
| FN3 | 1311..1397 | CDD:238020 | |||
| Integrase_Zn | 26..62 | CDD:396557 | |||
| rve | 78..172 | CDD:395538 | |||
| IN_DBD_C | 243..288 | CDD:395437 | |||
| Ig | 404..499 | CDD:416386 | |||
| Ig strand A | 406..410 | CDD:409353 | |||
| Ig strand A' | 413..418 | CDD:409353 | |||
| Ig strand B | 424..432 | CDD:409353 | |||
| Ig strand C | 437..443 | CDD:409353 | |||
| Ig strand C' | 445..448 | CDD:409353 | |||
| Ig strand D | 455..459 | CDD:409353 | |||
| Ig strand E | 461..467 | CDD:409353 | |||
| Ig strand F | 474..483 | CDD:409353 | |||
| Ig strand G | 486..499 | CDD:409353 | |||
| Ig | 508..593 | CDD:416386 | 10/43 (23%) | ||
| Ig strand A | 509..514 | CDD:409353 | |||
| Ig strand B | 518..524 | CDD:409353 | |||
| Ig strand C | 532..538 | CDD:409353 | |||
| Ig strand C' | 543..545 | CDD:409353 | |||
| Ig strand D | 550..555 | CDD:409353 | 0/1 (0%) | ||
| Ig strand E | 558..562 | CDD:409353 | 0/4 (0%) | ||
| Ig strand F | 572..580 | CDD:409353 | 2/10 (20%) | ||
| Ig strand G | 582..593 | CDD:409353 | 0/10 (0%) | ||
| Ig | 606..693 | CDD:416386 | 22/89 (25%) | ||
| Ig strand A | 606..611 | CDD:409353 | 1/4 (25%) | ||
| Ig strand A' | 614..619 | CDD:409353 | 1/4 (25%) | ||
| Ig strand B | 622..631 | CDD:409353 | 3/10 (30%) | ||
| Ig strand C | 637..641 | CDD:409353 | 0/3 (0%) | ||
| Ig strand C' | 644..646 | CDD:409353 | 0/1 (0%) | ||
| Ig strand D | 654..657 | CDD:409353 | 0/2 (0%) | ||
| Ig strand E | 658..663 | CDD:409353 | 1/4 (25%) | ||
| Ig strand F | 671..679 | CDD:409353 | 3/7 (43%) | ||
| Ig strand G | 682..693 | CDD:409353 | 3/10 (30%) | ||
| Ig | 698..781 | CDD:416386 | 30/90 (33%) | ||
| Ig strand A' | 704..708 | CDD:409353 | 2/6 (33%) | ||
| Ig strand B | 712..720 | CDD:409353 | 3/7 (43%) | ||
| Ig strand C | 726..731 | CDD:409353 | 2/4 (50%) | ||
| Ig strand C' | 733..736 | CDD:409353 | 0/2 (0%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||