DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Lac and Lrit1

DIOPT Version :9

Sequence 1:	NP_523713.2	Gene:	Lac / 36363	FlyBaseID:	FBgn0010238	Length:	359	Species:	Drosophila melanogaster
Sequence 2:	NP_666357.2	Gene:	Lrit1 / 239037	MGIID:	2385320	Length:	624	Species:	Mus musculus

Alignment Length:	180	Identity:	41/180 - (22%)
Similarity:	71/180 - (39%)	Gaps:	46/180 - (25%)

- Green bases have known domain annotations that are detailed below.

  Fly   125 AEVKLSVRRPPVISDNSTQSVVASEGSEVQMECYASGYPTPTITWRRENNAIL--------PTDS 181
            ::::|...:.|.:....| |:::..||.|.:.|.|:|.|.|.::|||.|...|        .:|.
Mouse   245 SQLELRKCQSPELRPGVT-SIISPLGSTVLLRCGATGIPGPEMSWRRANGRPLNGTVHQEVSSDG 308

  Fly   182 ATYVGNTLRIKSVKKEDRGTYYCVADN--GVSKGDRRNINVEVEFAPVITVPRPRLG-------- 236
            :::  ..|.:..|...|.|.|.|.|.|  |.|         |...:.::|.|:...|
Mouse   309 SSW--TLLDLPVVSLFDSGDYICQAKNFLGAS---------ETLISLIVTEPQTSTGYSGIPGVL 362

  Fly   237 --------QALQYDMDLEC--------HIEAYPPPAIVWTKDDIQLANNQ 270
                    :|..|:..|..        |:.....|::...|:::.|.|.|
Mouse   363 WARTGEGAEAAAYNNKLVARHVPHMPEHVALATKPSMPSIKEELALQNFQ 412

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Lac	NP_523713.2	IG_like	36..131	CDD:214653	1/5 (20%)
		FR1	37..50	CDD:409353
		Ig strand A'	37..42	CDD:409353
		Ig strand B	44..51	CDD:409353
		CDR1	51..59	CDD:409353
		Ig strand C	59..63	CDD:409353
		FR2	60..63	CDD:409353
		CDR2	67..81	CDD:409353
		Ig strand C'	68..72	CDD:409353
		Ig strand C'	79..81	CDD:409353
		FR3	84..115	CDD:409353
		Ig strand D	84..90	CDD:409353
		Ig strand E	94..102	CDD:409353
		Ig strand F	108..115	CDD:409353
		CDR3	116..124	CDD:409353
		FR4	124..130	CDD:409353	0/4 (0%)
		Ig strand G	124..130	CDD:409353	0/4 (0%)
		Ig_3	134..208	CDD:404760	24/81 (30%)
		Ig strand B	153..157	CDD:409353	1/3 (33%)
		Ig strand C	166..170	CDD:409353	0/3 (0%)
		Ig strand E	187..191	CDD:409353	1/3 (33%)
		Ig strand F	201..206	CDD:409353	2/4 (50%)
		Ig strand G	215..218	CDD:409353	0/2 (0%)
		Ig	227..318	CDD:416386	12/68 (18%)
		Ig strand C	256..260	CDD:409353	0/3 (0%)
		Ig strand E	286..290	CDD:409353
		Ig strand F	300..305	CDD:409353
Lrit1	NP_666357.2	LRRNT	23..61	CDD:214470
		LRR 1	60..81
		LRR_8	63..143	CDD:290566
		leucine-rich repeat	64..84	CDD:275378
		LRR 2	84..105
		leucine-rich repeat	85..132	CDD:275378
		LRR 3	108..129
		LRR_8	131..>176	CDD:290566
		LRR_4	131..172	CDD:289563
		LRR 4	132..153
		leucine-rich repeat	133..156	CDD:275378
		LRR 5	156..177
		leucine-rich repeat	157..180	CDD:275378
		leucine-rich repeat	181..205	CDD:275378
		TPKR_C2	201..>241	CDD:301599
		Ig	258..346	CDD:299845	27/99 (27%)
		IG_like	268..346	CDD:214653	25/88 (28%)
		FN3	432..502	CDD:214495
		LRR 6	526..549
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3510
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900