DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lac and Iglon5

DIOPT Version :10

Sequence 1:NP_523713.2 Gene:Lac / 36363 FlyBaseID:FBgn0010238 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001157990.1 Gene:Iglon5 / 210094 MGIID:2686277 Length:336 Species:Mus musculus


Alignment Length:317 Identity:93/317 - (29%)
Similarity:126/317 - (39%) Gaps:57/317 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 VQQTLAQRTPTISYITQEQIKDIGGTVEFDC-------SVQYAKEYNVLFLKTD---SDP---VF 71
            :.|:|...:|..:|...|     |......|       .|.:....|:|:...|   |||   :.
Mouse    29 LSQSLEFSSPADNYTVCE-----GDNATLSCFIDEHVTRVAWLNRSNILYAGNDRWTSDPRVRLL 88

  Fly    72 LSTGSTLVIKDSRFSLRYDPNSSTYKLQIKDIQETDAGTYTCQVVISTVHK-VSAEVKLSVRRPP 135
            ::|                  ...:.:.|..:...|.|.|||.  ..|.|: .:.:|.|.|..|.
Mouse    89 INT------------------PEEFSILITQVGLGDEGLYTCS--FQTRHQPYTTQVYLIVHVPA 133

  Fly   136 VISDNSTQSVVASEGSEVQMECYASGYPTPTITWRRENNAILPTDSATYVGNTLRIKSVKKEDRG 200
            .|. |.:..|..:||..|.:.|.|.|.|.||:|||:..      |..|..|..|.|..:::...|
Mouse   134 RIV-NISSPVAVNEGGNVNLLCLAVGRPEPTVTWRQLR------DGFTSEGEILEISDIQRGQAG 191

  Fly   201 TYYCVADNGV-SKGDRRNINVEVEFAPVI---TVPRPRLGQALQYDMDLECHIEAYPPPAIVWTK 261
            .|.||..||| |..|.|.:.|.|.:.|.|   |..|..||:|..    |.|...|.||....|.|
Mouse   192 EYECVTHNGVNSAPDSRRVLVTVNYPPTITDVTSARTALGRAAL----LRCEAMAVPPADFQWYK 252

  Fly   262 DDIQLANNQHYSISHFATADEYTDSTLRVITVEKRQYGDYVCKATNRFGEAEARVNL 318
            ||..|::.   |........|.|.|.|....|..|.||:|.|:|.||.|.:.|.:.|
Mouse   253 DDRLLSSG---SAEGLKVQTERTRSMLLFANVSARHYGNYTCRAANRLGASSASMRL 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LacNP_523713.2 IG_like 36..131 CDD:214653 21/108 (19%)
Ig strand B 46..50 CDD:409381 0/3 (0%)
Ig strand C 60..63 CDD:409381 1/2 (50%)
Ig strand E 96..100 CDD:409381 0/3 (0%)
Ig strand F 110..115 CDD:409381 3/4 (75%)
Ig strand G 124..127 CDD:409381 0/2 (0%)
Ig_3 134..208 CDD:464046 25/73 (34%)
Ig 227..318 CDD:472250 32/93 (34%)
Ig strand C 256..260 CDD:409353 0/3 (0%)
Ig strand E 286..290 CDD:409353 2/3 (67%)
Ig strand F 300..305 CDD:409353 2/4 (50%)
Iglon5NP_001157990.1 Ig 41..129 CDD:472250 22/112 (20%)
Ig strand B 50..54 CDD:409382 0/3 (0%)
Ig strand C 62..66 CDD:409382 1/3 (33%)
Ig strand E 95..99 CDD:409382 0/3 (0%)
Ig strand F 109..114 CDD:409382 3/6 (50%)
Ig strand G 122..125 CDD:409382 0/2 (0%)
Ig_3 134..199 CDD:464046 24/71 (34%)
Ig_3 217..295 CDD:464046 29/84 (35%)

Return to query results.
Submit another query.