Sequence 1: | NP_523713.2 | Gene: | Lac / 36363 | FlyBaseID: | FBgn0010238 | Length: | 359 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001157990.1 | Gene: | Iglon5 / 210094 | MGIID: | 2686277 | Length: | 336 | Species: | Mus musculus |
Alignment Length: | 317 | Identity: | 93/317 - (29%) |
---|---|---|---|
Similarity: | 126/317 - (39%) | Gaps: | 57/317 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 20 VQQTLAQRTPTISYITQEQIKDIGGTVEFDC-------SVQYAKEYNVLFLKTD---SDP---VF 71
Fly 72 LSTGSTLVIKDSRFSLRYDPNSSTYKLQIKDIQETDAGTYTCQVVISTVHK-VSAEVKLSVRRPP 135
Fly 136 VISDNSTQSVVASEGSEVQMECYASGYPTPTITWRRENNAILPTDSATYVGNTLRIKSVKKEDRG 200
Fly 201 TYYCVADNGV-SKGDRRNINVEVEFAPVI---TVPRPRLGQALQYDMDLECHIEAYPPPAIVWTK 261
Fly 262 DDIQLANNQHYSISHFATADEYTDSTLRVITVEKRQYGDYVCKATNRFGEAEARVNL 318 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Lac | NP_523713.2 | IG_like | 36..131 | CDD:214653 | 21/108 (19%) |
FR1 | 37..50 | CDD:409353 | 2/12 (17%) | ||
Ig strand A' | 37..42 | CDD:409353 | 1/4 (25%) | ||
Ig strand B | 44..51 | CDD:409353 | 1/13 (8%) | ||
CDR1 | 51..59 | CDD:409353 | 1/7 (14%) | ||
Ig strand C | 59..63 | CDD:409353 | 2/3 (67%) | ||
FR2 | 60..63 | CDD:409353 | 1/2 (50%) | ||
CDR2 | 67..81 | CDD:409353 | 4/16 (25%) | ||
Ig strand C' | 68..72 | CDD:409353 | 2/6 (33%) | ||
Ig strand C' | 79..81 | CDD:409353 | 0/1 (0%) | ||
FR3 | 84..115 | CDD:409353 | 6/30 (20%) | ||
Ig strand D | 84..90 | CDD:409353 | 0/5 (0%) | ||
Ig strand E | 94..102 | CDD:409353 | 1/7 (14%) | ||
Ig strand F | 108..115 | CDD:409353 | 4/6 (67%) | ||
CDR3 | 116..124 | CDD:409353 | 2/8 (25%) | ||
FR4 | 124..130 | CDD:409353 | 1/5 (20%) | ||
Ig strand G | 124..130 | CDD:409353 | 1/5 (20%) | ||
Ig_3 | 134..208 | CDD:404760 | 25/73 (34%) | ||
Ig strand B | 153..157 | CDD:409353 | 1/3 (33%) | ||
Ig strand C | 166..170 | CDD:409353 | 2/3 (67%) | ||
Ig strand E | 187..191 | CDD:409353 | 1/3 (33%) | ||
Ig strand F | 201..206 | CDD:409353 | 2/4 (50%) | ||
Ig strand G | 215..218 | CDD:409353 | 1/2 (50%) | ||
Ig | 227..318 | CDD:416386 | 32/93 (34%) | ||
Ig strand C | 256..260 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 286..290 | CDD:409353 | 2/3 (67%) | ||
Ig strand F | 300..305 | CDD:409353 | 2/4 (50%) | ||
Iglon5 | NP_001157990.1 | Ig | 41..129 | CDD:416386 | 22/112 (20%) |
Ig strand A' | 41..46 | CDD:409353 | 1/4 (25%) | ||
Ig strand B | 48..56 | CDD:409353 | 1/7 (14%) | ||
CDR1 | 56..60 | CDD:409353 | 0/3 (0%) | ||
FR2 | 61..68 | CDD:409353 | 1/6 (17%) | ||
Ig strand C | 61..67 | CDD:409353 | 1/5 (20%) | ||
CDR2 | 69..79 | CDD:409353 | 3/9 (33%) | ||
Ig strand C' | 71..74 | CDD:409353 | 1/2 (50%) | ||
Ig strand C' | 76..79 | CDD:409353 | 1/2 (50%) | ||
FR3 | 80..115 | CDD:409353 | 10/54 (19%) | ||
Ig strand D | 84..91 | CDD:409353 | 0/6 (0%) | ||
Ig strand E | 94..100 | CDD:409353 | 0/5 (0%) | ||
Ig strand F | 107..115 | CDD:409353 | 4/9 (44%) | ||
CDR3 | 116..120 | CDD:409353 | 2/3 (67%) | ||
Ig strand G | 120..129 | CDD:409353 | 2/8 (25%) | ||
FR4 | 122..129 | CDD:409353 | 2/6 (33%) | ||
Ig strand A | 132..137 | CDD:409353 | 2/5 (40%) | ||
Ig_3 | 134..199 | CDD:404760 | 24/71 (34%) | ||
Ig strand A' | 140..145 | CDD:409353 | 1/4 (25%) | ||
Ig strand B | 148..157 | CDD:409353 | 2/8 (25%) | ||
Ig strand C | 163..167 | CDD:409353 | 2/3 (67%) | ||
Ig strand D | 174..177 | CDD:409353 | 1/2 (50%) | ||
Ig strand E | 178..183 | CDD:409353 | 1/4 (25%) | ||
Ig strand F | 191..199 | CDD:409353 | 4/7 (57%) | ||
Ig_3 | 217..295 | CDD:404760 | 29/84 (35%) | ||
putative Ig strand A | 218..224 | CDD:409353 | 2/5 (40%) | ||
Ig strand B | 234..238 | CDD:409353 | 1/7 (14%) | ||
Ig strand C | 247..251 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 274..278 | CDD:409353 | 2/3 (67%) | ||
Ig strand F | 288..293 | CDD:409353 | 2/4 (50%) | ||
Ig strand G | 301..304 | CDD:409353 | 1/2 (50%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167833589 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D265311at33208 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0000150 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X97 | |
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
7 | 6.750 |