DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Lac and HTRA4

DIOPT Version :9

Sequence 1:	NP_523713.2	Gene:	Lac / 36363	FlyBaseID:	FBgn0010238	Length:	359	Species:	Drosophila melanogaster
Sequence 2:	NP_710159.1	Gene:	HTRA4 / 203100	HGNCID:	26909	Length:	476	Species:	Homo sapiens

Alignment Length:	174	Identity:	34/174 - (19%)
Similarity:	62/174 - (35%)	Gaps:	47/174 - (27%)

- Green bases have known domain annotations that are detailed below.

  Fly    26 QRTPTISYITQEQI--KDIG------GTVEFDCSVQYAKEYNVLFLKTDSDPVFLST-----GST 77
            |.|.|...::.:|.  |::|      ..|:.|.::.|......| :..|.|.:.:::     |.:
Human   287 QNTATAGIVSTKQRGGKELGMKDSDMDYVQIDATINYGNSGGPL-VNLDGDVIGVNSLRVTDGIS 350

  Fly    78 LVIKDSR---FSLRYD------------------------PNSSTYKLQIKDIQETDAGTYTCQV 115
            ..|...|   |...|.                        |.|...|:...|..:..:|.|.|:|
Human   351 FAIPSDRVRQFLAEYHEHQMKGKAFSNKKYLGLQMLSLTVPLSEELKMHYPDFPDVSSGVYVCKV 415

  Fly   116 VISTVHKVSA----EVKLSVRRPPVISDNSTQSVVASEGSEVQM 155
            |..|..:.|.    :|.:::...|:.:  :|..|.|.:...:.|
Human   416 VEGTAAQSSGLRDHDVIVNINGKPITT--TTDVVKALDSDSLSM 457

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Lac	NP_523713.2	IG_like	36..131	CDD:214653	26/138 (19%)
		FR1	37..50	CDD:409353	4/20 (20%)
		Ig strand A'	37..42	CDD:409353	2/6 (33%)
		Ig strand B	44..51	CDD:409353	2/6 (33%)
		CDR1	51..59	CDD:409353	1/7 (14%)
		Ig strand C	59..63	CDD:409353	1/3 (33%)
		FR2	60..63	CDD:409353	1/2 (50%)
		CDR2	67..81	CDD:409353	2/18 (11%)
		Ig strand C'	68..72	CDD:409353	1/3 (33%)
		Ig strand C'	79..81	CDD:409353	0/1 (0%)
		FR3	84..115	CDD:409353	10/57 (18%)
		Ig strand D	84..90	CDD:409353	2/8 (25%)
		Ig strand E	94..102	CDD:409353	1/7 (14%)
		Ig strand F	108..115	CDD:409353	3/6 (50%)
		CDR3	116..124	CDD:409353	2/7 (29%)
		FR4	124..130	CDD:409353	2/9 (22%)
		Ig strand G	124..130	CDD:409353	2/9 (22%)
		Ig_3	134..208	CDD:404760	5/22 (23%)
		Ig strand B	153..157	CDD:409353	1/3 (33%)
		Ig strand C	166..170	CDD:409353
		Ig strand E	187..191	CDD:409353
		Ig strand F	201..206	CDD:409353
		Ig strand G	215..218	CDD:409353
		Ig	227..318	CDD:416386
		Ig strand C	256..260	CDD:409353
		Ig strand E	286..290	CDD:409353
		Ig strand F	300..305	CDD:409353
HTRA4	NP_710159.1	IGFBP	40..94	CDD:278641
		Kazal_2	108..152	CDD:284958
		DegQ	156..470	CDD:223343	34/174 (20%)
		Serine protease	202..362		15/75 (20%)
		Trypsin_2	202..340	CDD:290102	12/53 (23%)
		PDZ_serine_protease	380..470	CDD:238487	17/80 (21%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910