| Sequence 1: | NP_523713.2 | Gene: | Lac / 36363 | FlyBaseID: | FBgn0010238 | Length: | 359 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_509336.1 | Gene: | zig-3 / 192088 | WormBaseID: | WBGene00006980 | Length: | 251 | Species: | Caenorhabditis elegans |
| Alignment Length: | 230 | Identity: | 48/230 - (20%) |
|---|---|---|---|
| Similarity: | 76/230 - (33%) | Gaps: | 78/230 - (33%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 137 ISDNSTQSVVASEGSEVQMECYASGYPTPTITWRREN----------------NAILPTDSATYV 185
Fly 186 GNTLRIKSVKKEDRGTYYCVADNG---------VS--------KGDRRNINVEVEFAPVITVPRP 233
Fly 234 RLGQALQYDMDLECHIEAYPPPAIV-----------WTKDDIQL-ANNQHYSISHFATADEYTDS 286
Fly 287 TLRVITVEKRQYGDYVCKATNRFGEAEARVNLFET 321 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Lac | NP_523713.2 | IG_like | 36..131 | CDD:214653 | |
| FR1 | 37..50 | CDD:409353 | |||
| Ig strand A' | 37..42 | CDD:409353 | |||
| Ig strand B | 44..51 | CDD:409353 | |||
| CDR1 | 51..59 | CDD:409353 | |||
| Ig strand C | 59..63 | CDD:409353 | |||
| FR2 | 60..63 | CDD:409353 | |||
| CDR2 | 67..81 | CDD:409353 | |||
| Ig strand C' | 68..72 | CDD:409353 | |||
| Ig strand C' | 79..81 | CDD:409353 | |||
| FR3 | 84..115 | CDD:409353 | |||
| Ig strand D | 84..90 | CDD:409353 | |||
| Ig strand E | 94..102 | CDD:409353 | |||
| Ig strand F | 108..115 | CDD:409353 | |||
| CDR3 | 116..124 | CDD:409353 | |||
| FR4 | 124..130 | CDD:409353 | |||
| Ig strand G | 124..130 | CDD:409353 | |||
| Ig_3 | 134..208 | CDD:404760 | 20/86 (23%) | ||
| Ig strand B | 153..157 | CDD:409353 | 1/3 (33%) | ||
| Ig strand C | 166..170 | CDD:409353 | 1/3 (33%) | ||
| Ig strand E | 187..191 | CDD:409353 | 0/3 (0%) | ||
| Ig strand F | 201..206 | CDD:409353 | 2/4 (50%) | ||
| Ig strand G | 215..218 | CDD:409353 | 2/2 (100%) | ||
| Ig | 227..318 | CDD:416386 | 18/102 (18%) | ||
| Ig strand C | 256..260 | CDD:409353 | 1/14 (7%) | ||
| Ig strand E | 286..290 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 300..305 | CDD:409353 | 2/4 (50%) | ||
| zig-3 | NP_509336.1 | I-set | 45..145 | CDD:254352 | 22/99 (22%) |
| Ig | 61..142 | CDD:143165 | 18/80 (23%) | ||
| IG_like | 177..244 | CDD:214653 | 12/74 (16%) | ||
| Ig | <191..237 | CDD:299845 | 10/53 (19%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||