Sequence 1: | NP_523713.2 | Gene: | Lac / 36363 | FlyBaseID: | FBgn0010238 | Length: | 359 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_510069.1 | Gene: | zig-2 / 192087 | WormBaseID: | WBGene00006979 | Length: | 238 | Species: | Caenorhabditis elegans |
Alignment Length: | 199 | Identity: | 47/199 - (23%) |
---|---|---|---|
Similarity: | 73/199 - (36%) | Gaps: | 35/199 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 150 GSEVQMECYASGYPTPTITWRRENNAILPTDSATYVGNTL----------------RIKSVKKED 198
Fly 199 RGTYYCVADNGVSK----------GDRRNINVEVEFAPVITVPRPRLGQALQYDMDLECHIEAYP 253
Fly 254 PPAIVWTKDDIQLANNQHYSISHFATADEYTDSTLRVITVEKRQYGDYVCKATNRFGEAEARVNL 318
Fly 319 FETI 322 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Lac | NP_523713.2 | IG_like | 36..131 | CDD:214653 | |
FR1 | 37..50 | CDD:409353 | |||
Ig strand A' | 37..42 | CDD:409353 | |||
Ig strand B | 44..51 | CDD:409353 | |||
CDR1 | 51..59 | CDD:409353 | |||
Ig strand C | 59..63 | CDD:409353 | |||
FR2 | 60..63 | CDD:409353 | |||
CDR2 | 67..81 | CDD:409353 | |||
Ig strand C' | 68..72 | CDD:409353 | |||
Ig strand C' | 79..81 | CDD:409353 | |||
FR3 | 84..115 | CDD:409353 | |||
Ig strand D | 84..90 | CDD:409353 | |||
Ig strand E | 94..102 | CDD:409353 | |||
Ig strand F | 108..115 | CDD:409353 | |||
CDR3 | 116..124 | CDD:409353 | |||
FR4 | 124..130 | CDD:409353 | |||
Ig strand G | 124..130 | CDD:409353 | |||
Ig_3 | 134..208 | CDD:404760 | 16/73 (22%) | ||
Ig strand B | 153..157 | CDD:409353 | 0/3 (0%) | ||
Ig strand C | 166..170 | CDD:409353 | 1/3 (33%) | ||
Ig strand E | 187..191 | CDD:409353 | 2/19 (11%) | ||
Ig strand F | 201..206 | CDD:409353 | 2/4 (50%) | ||
Ig strand G | 215..218 | CDD:409353 | 0/2 (0%) | ||
Ig | 227..318 | CDD:416386 | 21/90 (23%) | ||
Ig strand C | 256..260 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 286..290 | CDD:409353 | 1/3 (33%) | ||
Ig strand F | 300..305 | CDD:409353 | 2/4 (50%) | ||
zig-2 | NP_510069.1 | I-set | 34..134 | CDD:254352 | 20/86 (23%) |
Ig | 34..121 | CDD:299845 | 16/73 (22%) | ||
Ig | <179..232 | CDD:299845 | 17/61 (28%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |