DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lac and zig-10

DIOPT Version :10

Sequence 1:NP_523713.2 Gene:Lac / 36363 FlyBaseID:FBgn0010238 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001122644.1 Gene:zig-10 / 188896 WormBaseID:WBGene00020800 Length:322 Species:Caenorhabditis elegans


Alignment Length:255 Identity:60/255 - (23%)
Similarity:98/255 - (38%) Gaps:75/255 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 TVHKVSAEVKLSVRRPPVISDNSTQSVVASEGSEVQMECYASGYPTPTITWRRENNAILPTDSAT 183
            |:|.::.:...:.|..|:             ||...:||  ..|.:..:||.|:.:.|     ||
 Worm    21 TIHTLAPKKAPTERLVPI-------------GSTTALEC--EPYTSSNVTWYRDKHVI-----AT 65

  Fly   184 YVGNT---------------------LRIKSVKKEDRGTYYCVADNGVSKG----------DRRN 217
            ..|:.                     |.|..|:|||.|.|||..:|....|          |..:
 Worm    66 VEGHKNAILNERKPRGGEERIPEIGFLVIFDVQKEDEGNYYCQRENDSKWGEVFQLKIAYVDEIS 130

  Fly   218 INVEVEFAPVITVPRPRLGQALQYDMDLECHI-EAYPPPAIVWTKDDIQLANNQHYSISHFATAD 281
            .|.:::..|.:    |.||::|.    |.|.| :|||||.:.||.:.:.::   |.|..:.|   
 Worm   131 QNEKIKLEPNV----PTLGRSLV----LHCPIPKAYPPPKVTWTVNSLPIS---HISSDYVA--- 181

  Fly   282 EYTDSTLRVITVEKRQYGDYVCK--------ATNRFGEAEARVNLFETIIPVCPPACGQA 333
             :.:.||.:.......:|.:.|.        :||.|.::...|...|::.|.....|..|
 Worm   182 -FPNGTLIISHFSYHHFGYFECNINNFAGHASTNTFIDSRELVANLESLKPTFVNGCSAA 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LacNP_523713.2 IG_like 36..131 CDD:214653 2/11 (18%)
Ig strand B 46..50 CDD:409381
Ig strand C 60..63 CDD:409381
Ig strand E 96..100 CDD:409381
Ig strand F 110..115 CDD:409381
Ig strand G 124..127 CDD:409381 0/2 (0%)
Ig_3 134..208 CDD:464046 23/94 (24%)
Ig 227..318 CDD:472250 25/99 (25%)
Ig strand C 256..260 CDD:409353 0/3 (0%)
Ig strand E 286..290 CDD:409353 2/3 (67%)
Ig strand F 300..305 CDD:409353 1/12 (8%)
zig-10NP_001122644.1 IG_like 31..118 CDD:214653 26/106 (25%)
Ig strand B 42..46 CDD:409353 0/3 (0%)
Ig strand C 53..57 CDD:409353 1/3 (33%)
Ig strand E 91..94 CDD:409353 1/2 (50%)
Ig strand F 104..109 CDD:409353 3/4 (75%)
Ig_3 134..206 CDD:464046 22/86 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.