DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lac and Ncam1

DIOPT Version :9

Sequence 1:NP_523713.2 Gene:Lac / 36363 FlyBaseID:FBgn0010238 Length:359 Species:Drosophila melanogaster
Sequence 2:XP_006510118.1 Gene:Ncam1 / 17967 MGIID:97281 Length:1162 Species:Mus musculus


Alignment Length:320 Identity:78/320 - (24%)
Similarity:146/320 - (45%) Gaps:43/320 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 STLLLAIFVQQTLAQRTPTISYITQEQIKDIGGTVEFDCSVQYAKEYNVLFLKTDSDPVFLSTGS 76
            :|:.:.|| |:.:.:..|     |.::.|: |......|.|..:....:::.....|        
Mouse   108 ATVNVKIF-QKLMFKNAP-----TPQEFKE-GEDAVIVCDVVSSLPPTIIWKHKGRD-------- 157

  Fly    77 TLVIKDSRFSLRYDPNSSTYKLQIKDIQETDAGTYTCQVVISTVHKVS-AEVKLSVRRPPVISDN 140
            .::.||.||.:.    |:.| |||:.|::||.|||.|:..|....::: .::::.|..||.:  .
Mouse   158 VILKKDVRFIVL----SNNY-LQIRGIKKTDEGTYRCEGRILARGEINFKDIQVIVNVPPTV--Q 215

  Fly   141 STQSVV---ASEGSEVQMECYASGYPTPTITWRRENNAI--LPTDSATYV----GNTLRIKSVKK 196
            :.||:|   |:.|..|.:.|.|.|:|.||::|.::...|  ...|...::    .:.|.|::|.|
Mouse   216 ARQSIVNATANLGQSVTLVCDADGFPEPTMSWTKDGEPIENEEEDDEKHIFSDDSSELTIRNVDK 280

  Fly   197 EDRGTYYCVADNGVSKGDRRNINVEVEFAPVITVPRPRLGQALQYDMDLECHIEAYPPPAIVWTK 261
            .|...|.|:|:|...:.| .:|:::|...|.||....:....|:..:.|.|.....|.|:|.|..
Mouse   281 NDEAEYVCIAENKAGEQD-ASIHLKVFAKPKITYVENQTAMELEEQVTLTCEASGDPIPSITWRT 344

  Fly   262 DDIQLANNQHYSIS----------HFATADEYTDSTLRVITVEKRQYGDYVCKATNRFGE 311
            ....:::.:..|.:          |.........|:|.:.:::....|:|:|.|:|..|:
Mouse   345 STRNISSEEKASWTRPEKQETLDGHMVVRSHARVSSLTLKSIQYTDAGEYICTASNTIGQ 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LacNP_523713.2 IG_like 36..131 CDD:214653 22/95 (23%)
FR1 37..50 CDD:409353 2/12 (17%)
Ig strand A' 37..42 CDD:409353 1/4 (25%)
Ig strand B 44..51 CDD:409353 0/6 (0%)
CDR1 51..59 CDD:409353 1/7 (14%)
Ig strand C 59..63 CDD:409353 0/3 (0%)
FR2 60..63 CDD:409353 0/2 (0%)
CDR2 67..81 CDD:409353 1/13 (8%)
Ig strand C' 68..72 CDD:409353 1/3 (33%)
Ig strand C' 79..81 CDD:409353 0/1 (0%)
FR3 84..115 CDD:409353 14/30 (47%)
Ig strand D 84..90 CDD:409353 2/5 (40%)
Ig strand E 94..102 CDD:409353 4/7 (57%)
Ig strand F 108..115 CDD:409353 4/6 (67%)
CDR3 116..124 CDD:409353 1/7 (14%)
FR4 124..130 CDD:409353 0/6 (0%)
Ig strand G 124..130 CDD:409353 0/6 (0%)
Ig_3 134..208 CDD:404760 25/82 (30%)
Ig strand B 153..157 CDD:409353 1/3 (33%)
Ig strand C 166..170 CDD:409353 1/3 (33%)
Ig strand E 187..191 CDD:409353 1/3 (33%)
Ig strand F 201..206 CDD:409353 2/4 (50%)
Ig strand G 215..218 CDD:409353 0/2 (0%)
Ig 227..318 CDD:416386 19/95 (20%)
Ig strand C 256..260 CDD:409353 1/3 (33%)
Ig strand E 286..290 CDD:409353 2/3 (67%)
Ig strand F 300..305 CDD:409353 2/4 (50%)
Ncam1XP_006510118.1 Ig1_NCAM-1 20..115 CDD:143273 1/6 (17%)
IG 124..190 CDD:214652 22/84 (26%)
Ig3_NCAM-1_like 211..308 CDD:143207 29/99 (29%)
Ig_NCAM-1 307..413 CDD:143277 20/98 (20%)
Ig_3 417..494 CDD:372822
FN3 509..606 CDD:238020
fn3 649..731 CDD:365830
PHA03247 <905..1140 CDD:223021
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.