DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lac and rig-5

DIOPT Version :9

Sequence 1:NP_523713.2 Gene:Lac / 36363 FlyBaseID:FBgn0010238 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001251131.1 Gene:rig-5 / 172791 WormBaseID:WBGene00004372 Length:482 Species:Caenorhabditis elegans


Alignment Length:313 Identity:86/313 - (27%)
Similarity:150/313 - (47%) Gaps:11/313 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LLAIFVQQTLAQRTPTISYITQEQ-IKDIGGTVEFDCSVQYAKEYNVLFLKTDSDPVFLSTGSTL 78
            :|.:|.|.......|||...:... :..:|..|:|.|.|.....:.|.|:|.||.|..||....:
 Worm    70 VLLVFKQACSRGAPPTIQQPSMSSAVALLGQDVDFTCIVNDLGSHMVAFVKADSPPRLLSFDEKV 134

  Fly    79 VIKDSRFSL--RYDPNSSTYKLQIKDIQETDAGTYTCQVVISTVHKVSAEVKLSVRRPPVISDNS 141
            ..:.:::.|  |.....:.:.|.||::||:|.|.|:||:....:...:.|  |.|:.|||:|.::
 Worm   135 FRRRNKYELKPRIGDLHNEWVLTIKNVQESDRGNYSCQINTEPITLSTGE--LDVKVPPVVSRST 197

  Fly   142 TQSVVASEGSEVQMECYASGYPTPTITWRRENNAILPTDSAT------YVGNTLRIKSVKKEDRG 200
            ..:|...||:.|.:.|.|.|.||||:.|||::..|:..:.||      :.|..|.:..|.::...
 Worm   198 PAAVEVREGNNVSLTCKADGNPTPTVIWRRQDRQIIRYNGATGFGASVFHGPVLHLTKVSRKHMS 262

  Fly   201 TYYCVADNGVSKGDRRNINVEVEFAPVITVPRPRLGQALQYDMDLECHIEAYPPPAIVWTKDDIQ 265
            .|.|||.||:...:...:.:.|.|.|::......:..::.....:.|..||:|.|.:.|.||...
 Worm   263 EYLCVASNGIPPDESWTVKLLVTFPPLVQAQSETVQASVGSMARMVCTTEAWPRPEMGWEKDGEP 327

  Fly   266 LANNQHYSISHFATADEYTDSTLRVITVEKRQYGDYVCKATNRFGEAEARVNL 318
            :..:.:.:::|..:...::...|.:..|:...:|.|.|.|.|..|...::|.|
 Worm   328 VYESNNVAMTHTVSGQYHSVHILEIRNVQSSHFGVYRCVAKNDNGIHHSQVTL 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LacNP_523713.2 IG_like 36..131 CDD:214653 27/97 (28%)
FR1 37..50 CDD:409353 3/13 (23%)
Ig strand A' 37..42 CDD:409353 0/5 (0%)
Ig strand B 44..51 CDD:409353 2/6 (33%)
CDR1 51..59 CDD:409353 1/7 (14%)
Ig strand C 59..63 CDD:409353 1/3 (33%)
FR2 60..63 CDD:409353 1/2 (50%)
CDR2 67..81 CDD:409353 4/13 (31%)
Ig strand C' 68..72 CDD:409353 1/3 (33%)
Ig strand C' 79..81 CDD:409353 0/1 (0%)
FR3 84..115 CDD:409353 11/32 (34%)
Ig strand D 84..90 CDD:409353 2/7 (29%)
Ig strand E 94..102 CDD:409353 2/7 (29%)
Ig strand F 108..115 CDD:409353 3/6 (50%)
CDR3 116..124 CDD:409353 0/7 (0%)
FR4 124..130 CDD:409353 1/5 (20%)
Ig strand G 124..130 CDD:409353 1/5 (20%)
Ig_3 134..208 CDD:404760 28/79 (35%)
Ig strand B 153..157 CDD:409353 1/3 (33%)
Ig strand C 166..170 CDD:409353 1/3 (33%)
Ig strand E 187..191 CDD:409353 1/3 (33%)
Ig strand F 201..206 CDD:409353 2/4 (50%)
Ig strand G 215..218 CDD:409353 0/2 (0%)
Ig 227..318 CDD:416386 18/90 (20%)
Ig strand C 256..260 CDD:409353 0/3 (0%)
Ig strand E 286..290 CDD:409353 1/3 (33%)
Ig strand F 300..305 CDD:409353 2/4 (50%)
rig-5NP_001251131.1 IG_like 92..189 CDD:214653 28/98 (29%)
Ig_3 191..270 CDD:372822 27/78 (35%)
IG 294..380 CDD:214652 18/85 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.