| Sequence 1: | NP_523713.2 | Gene: | Lac / 36363 | FlyBaseID: | FBgn0010238 | Length: | 359 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_309810.4 | Gene: | AgaP_AGAP010884 / 1271065 | VectorBaseID: | AGAP010884 | Length: | 1951 | Species: | Anopheles gambiae |
| Alignment Length: | 321 | Identity: | 84/321 - (26%) |
|---|---|---|---|
| Similarity: | 126/321 - (39%) | Gaps: | 73/321 - (22%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 64 KTDS---DPVFLSTGSTLVIKDSRFSLRYD---PNSSTYK-----------------------LQ 99
Fly 100 IKDIQETDAGTYTCQVVISTVHKVSAEVKLSVRRPPVIS-DNSTQSVVASEGSEVQMECYASGYP 163
Fly 164 TPTITWRRENNAILPTDSATYVGNTLRIKSVKKEDRGTYYCVADNGVSKGDRRNINVEVEF---- 224
Fly 225 ---APVITVPRPRLGQALQYDMDLECHIEAYPPPAIVWTKDDIQLANNQHYSISHFATADEYTDS 286
Fly 287 TLRVITVEKRQYGDYVCKATNRFGEAE--ARVNLF----------------ETIIPVCPPA 329 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Lac | NP_523713.2 | IG_like | 36..131 | CDD:214653 | 26/95 (27%) |
| FR1 | 37..50 | CDD:409353 | |||
| Ig strand A' | 37..42 | CDD:409353 | |||
| Ig strand B | 44..51 | CDD:409353 | |||
| CDR1 | 51..59 | CDD:409353 | |||
| Ig strand C | 59..63 | CDD:409353 | |||
| FR2 | 60..63 | CDD:409353 | |||
| CDR2 | 67..81 | CDD:409353 | 5/16 (31%) | ||
| Ig strand C' | 68..72 | CDD:409353 | 1/3 (33%) | ||
| Ig strand C' | 79..81 | CDD:409353 | 0/1 (0%) | ||
| FR3 | 84..115 | CDD:409353 | 13/56 (23%) | ||
| Ig strand D | 84..90 | CDD:409353 | 1/5 (20%) | ||
| Ig strand E | 94..102 | CDD:409353 | 4/30 (13%) | ||
| Ig strand F | 108..115 | CDD:409353 | 3/6 (50%) | ||
| CDR3 | 116..124 | CDD:409353 | 2/7 (29%) | ||
| FR4 | 124..130 | CDD:409353 | 2/5 (40%) | ||
| Ig strand G | 124..130 | CDD:409353 | 2/5 (40%) | ||
| Ig_3 | 134..208 | CDD:404760 | 24/74 (32%) | ||
| Ig strand B | 153..157 | CDD:409353 | 0/3 (0%) | ||
| Ig strand C | 166..170 | CDD:409353 | 1/3 (33%) | ||
| Ig strand E | 187..191 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 201..206 | CDD:409353 | 2/4 (50%) | ||
| Ig strand G | 215..218 | CDD:409353 | 0/2 (0%) | ||
| Ig | 227..318 | CDD:416386 | 22/92 (24%) | ||
| Ig strand C | 256..260 | CDD:409353 | 1/3 (33%) | ||
| Ig strand E | 286..290 | CDD:409353 | 2/3 (67%) | ||
| Ig strand F | 300..305 | CDD:409353 | 2/4 (50%) | ||
| AgaP_AGAP010884 | XP_309810.4 | Ig | 16..110 | CDD:299845 | |
| IG_like | 35..106 | CDD:214653 | |||
| I-set | 231..320 | CDD:254352 | 24/93 (26%) | ||
| Ig | 248..317 | CDD:143165 | 18/73 (25%) | ||
| I-set | 328..402 | CDD:254352 | 26/86 (30%) | ||
| IGc2 | 338..390 | CDD:197706 | 20/57 (35%) | ||
| IG_like | 417..504 | CDD:214653 | 21/86 (24%) | ||
| IGc2 | 423..494 | CDD:197706 | 16/70 (23%) | ||
| I-set | 510..593 | CDD:254352 | 6/22 (27%) | ||
| IGc2 | 521..584 | CDD:197706 | 6/11 (55%) | ||
| Ig | 619..689 | CDD:143165 | |||
| I-set | 696..788 | CDD:254352 | |||
| Ig | 715..788 | CDD:299845 | |||
| I-set | 794..889 | CDD:254352 | |||
| Ig | 808..896 | CDD:299845 | |||
| FN3 | 893..987 | CDD:238020 | |||
| FN3 | 994..1094 | CDD:238020 | |||
| FN3 | 1102..1195 | CDD:238020 | |||
| FN3 | 1200..1288 | CDD:238020 | |||
| Ig | 1315..1382 | CDD:299845 | |||
| FN3 | 1386..1475 | CDD:238020 | |||
| FN3 | 1480..1560 | CDD:238020 | |||
| Dscam_C | 1858..1949 | CDD:289151 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||