Sequence 1: | NP_523713.2 | Gene: | Lac / 36363 | FlyBaseID: | FBgn0010238 | Length: | 359 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005157462.1 | Gene: | ncam1b / 114442 | ZFINID: | ZDB-GENE-010822-2 | Length: | 1055 | Species: | Danio rerio |
Alignment Length: | 327 | Identity: | 82/327 - (25%) |
---|---|---|---|
Similarity: | 126/327 - (38%) | Gaps: | 71/327 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 17 AIFVQQTLAQRTPTISYITQEQIKDIGGTVEFDCSVQYAKEYNVLFLKTDSDPVFLSTGSTLVIK 81
Fly 82 DSRFSLRYDPNSSTYKLQIKDIQETDAGTYTCQVVISTVHKVS-AEVKLSVRRPPVISDNSTQ-S 144
Fly 145 VVASEGSEVQMECYASGYPTPTITWRRENNAILPTDSATYV-----GNTLRIKSVKKEDRGTYYC 204
Fly 205 VADNGVSKGDRRNINVEVEFAPVITVPRPRLGQALQYDMDLECHIEAYPPPAIVWT------KDD 263
Fly 264 IQLANNQHYSIS------HFATADEY---TDSTLRVITVEKRQY---GDYVCKATNRFGEAEARV 316
Fly 317 NL 318 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Lac | NP_523713.2 | IG_like | 36..131 | CDD:214653 | 22/95 (23%) |
FR1 | 37..50 | CDD:409353 | 3/12 (25%) | ||
Ig strand A' | 37..42 | CDD:409353 | 1/4 (25%) | ||
Ig strand B | 44..51 | CDD:409353 | 2/6 (33%) | ||
CDR1 | 51..59 | CDD:409353 | 0/7 (0%) | ||
Ig strand C | 59..63 | CDD:409353 | 0/3 (0%) | ||
FR2 | 60..63 | CDD:409353 | 0/2 (0%) | ||
CDR2 | 67..81 | CDD:409353 | 0/13 (0%) | ||
Ig strand C' | 68..72 | CDD:409353 | 0/3 (0%) | ||
Ig strand C' | 79..81 | CDD:409353 | 0/1 (0%) | ||
FR3 | 84..115 | CDD:409353 | 13/30 (43%) | ||
Ig strand D | 84..90 | CDD:409353 | 2/5 (40%) | ||
Ig strand E | 94..102 | CDD:409353 | 4/7 (57%) | ||
Ig strand F | 108..115 | CDD:409353 | 4/6 (67%) | ||
CDR3 | 116..124 | CDD:409353 | 1/7 (14%) | ||
FR4 | 124..130 | CDD:409353 | 1/6 (17%) | ||
Ig strand G | 124..130 | CDD:409353 | 1/6 (17%) | ||
Ig_3 | 134..208 | CDD:404760 | 25/79 (32%) | ||
Ig strand B | 153..157 | CDD:409353 | 0/3 (0%) | ||
Ig strand C | 166..170 | CDD:409353 | 1/3 (33%) | ||
Ig strand E | 187..191 | CDD:409353 | 0/3 (0%) | ||
Ig strand F | 201..206 | CDD:409353 | 2/4 (50%) | ||
Ig strand G | 215..218 | CDD:409353 | 0/2 (0%) | ||
Ig | 227..318 | CDD:416386 | 25/108 (23%) | ||
Ig strand C | 256..260 | CDD:409353 | 1/3 (33%) | ||
Ig strand E | 286..290 | CDD:409353 | 0/3 (0%) | ||
Ig strand F | 300..305 | CDD:409353 | 2/4 (50%) | ||
ncam1b | XP_005157462.1 | Ig | 20..112 | CDD:299845 | |
I-set | 21..111 | CDD:254352 | |||
IG_like | 121..205 | CDD:214653 | 27/114 (24%) | ||
IGc2 | 128..189 | CDD:197706 | 24/98 (24%) | ||
Ig | 208..301 | CDD:299845 | 27/96 (28%) | ||
I-set | 212..298 | CDD:254352 | 24/89 (27%) | ||
I-set | 298..414 | CDD:254352 | 28/115 (24%) | ||
Ig | 300..414 | CDD:299845 | 27/113 (24%) | ||
IG_like | 426..505 | CDD:214653 | |||
Ig | 434..505 | CDD:143165 | |||
FN3 | 513..606 | CDD:238020 | |||
FN3 | 629..720 | CDD:238020 | |||
Chorion_3 | <815..1019 | CDD:253174 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR12231 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.010 |