DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lac and ncam1b

DIOPT Version :9

Sequence 1:NP_523713.2 Gene:Lac / 36363 FlyBaseID:FBgn0010238 Length:359 Species:Drosophila melanogaster
Sequence 2:XP_005157462.1 Gene:ncam1b / 114442 ZFINID:ZDB-GENE-010822-2 Length:1055 Species:Danio rerio


Alignment Length:327 Identity:82/327 - (25%)
Similarity:126/327 - (38%) Gaps:71/327 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 AIFVQQTLAQRTPTISYITQEQIKDIGGTVEFDCSVQYAKEYNVLFLKTDSDPVFLSTGSTLVIK 81
            ||.|...::...||:.:      |..|..::||                               |
Zfish   132 AIIVCDVISSPPPTVLW------KYKGAKIQFD-------------------------------K 159

  Fly    82 DSRFSLRYDPNSSTYKLQIKDIQETDAGTYTCQVVISTVHKVS-AEVKLSVRRPPVISDNSTQ-S 144
            |.||.     ..|...|||:.|::||.|.|||:..|....:|. ..:|:.|...|.|.....: :
Zfish   160 DVRFK-----TLSNNHLQIRGIRKTDEGVYTCEGRIKARGEVDFRSIKVVVNVLPTIRIRQAETN 219

  Fly   145 VVASEGSEVQMECYASGYPTPTITWRRENNAILPTDSATYV-----GNTLRIKSVKKEDRGTYYC 204
            ..|..|....:.|...|:|.|.:|||| |||  |.:|....     |:.:.:..|.|.|.|.|.|
Zfish   220 ATADMGFSTLLACDPDGFPEPIVTWRR-NNA--PLESGNKYSFNEDGSEMTVLDVTKLDEGDYTC 281

  Fly   205 VADNGVSKGDRRNINVEVEFAPVITVPRPRLGQALQYDMDLECHIEAYPPPAIVWT------KDD 263
            :|.|...:.: :.::::|...|.||....:....:...:.|.|.....|.|.|.|:      .:.
Zfish   282 IAKNKAGESE-QELSLKVFVQPKITYLESQTTTEMDEQVTLTCEATGDPTPTITWSFGTRVFTEG 345

  Fly   264 IQLANNQHYSIS------HFATADEY---TDSTLRVITVEKRQY---GDYVCKATNRFGEAEARV 316
            .|....:.|..|      |.....|.   :|:.:..:|::..||   |.|:|.|.|..||....|
Zfish   346 EQEQQKRIYQASWTRPEQHKGPDGEVLVRSDARVSSLTLKYPQYTDAGQYLCTARNAIGETVQPV 410

  Fly   317 NL 318
            :|
Zfish   411 SL 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LacNP_523713.2 IG_like 36..131 CDD:214653 22/95 (23%)
FR1 37..50 CDD:409353 3/12 (25%)
Ig strand A' 37..42 CDD:409353 1/4 (25%)
Ig strand B 44..51 CDD:409353 2/6 (33%)
CDR1 51..59 CDD:409353 0/7 (0%)
Ig strand C 59..63 CDD:409353 0/3 (0%)
FR2 60..63 CDD:409353 0/2 (0%)
CDR2 67..81 CDD:409353 0/13 (0%)
Ig strand C' 68..72 CDD:409353 0/3 (0%)
Ig strand C' 79..81 CDD:409353 0/1 (0%)
FR3 84..115 CDD:409353 13/30 (43%)
Ig strand D 84..90 CDD:409353 2/5 (40%)
Ig strand E 94..102 CDD:409353 4/7 (57%)
Ig strand F 108..115 CDD:409353 4/6 (67%)
CDR3 116..124 CDD:409353 1/7 (14%)
FR4 124..130 CDD:409353 1/6 (17%)
Ig strand G 124..130 CDD:409353 1/6 (17%)
Ig_3 134..208 CDD:404760 25/79 (32%)
Ig strand B 153..157 CDD:409353 0/3 (0%)
Ig strand C 166..170 CDD:409353 1/3 (33%)
Ig strand E 187..191 CDD:409353 0/3 (0%)
Ig strand F 201..206 CDD:409353 2/4 (50%)
Ig strand G 215..218 CDD:409353 0/2 (0%)
Ig 227..318 CDD:416386 25/108 (23%)
Ig strand C 256..260 CDD:409353 1/3 (33%)
Ig strand E 286..290 CDD:409353 0/3 (0%)
Ig strand F 300..305 CDD:409353 2/4 (50%)
ncam1bXP_005157462.1 Ig 20..112 CDD:299845
I-set 21..111 CDD:254352
IG_like 121..205 CDD:214653 27/114 (24%)
IGc2 128..189 CDD:197706 24/98 (24%)
Ig 208..301 CDD:299845 27/96 (28%)
I-set 212..298 CDD:254352 24/89 (27%)
I-set 298..414 CDD:254352 28/115 (24%)
Ig 300..414 CDD:299845 27/113 (24%)
IG_like 426..505 CDD:214653
Ig 434..505 CDD:143165
FN3 513..606 CDD:238020
FN3 629..720 CDD:238020
Chorion_3 <815..1019 CDD:253174
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.