DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lac and ncam2

DIOPT Version :9

Sequence 1:NP_523713.2 Gene:Lac / 36363 FlyBaseID:FBgn0010238 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_571905.1 Gene:ncam2 / 114441 ZFINID:ZDB-GENE-010822-1 Length:795 Species:Danio rerio


Alignment Length:350 Identity:80/350 - (22%)
Similarity:140/350 - (40%) Gaps:63/350 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LAQRTPTISYITQEQIK---DIGGTVEFDCSVQYAKEYNVLF------LKTDSDPVFLSTGSTLV 79
            |....|.:..:.|:...   |.|.:|.|.|....:.|.:|.:      |:.....|..:.|:||.
Zfish   201 LVVNVPPVVSVPQQSFNATADYGESVTFTCRAYGSPEPDVTWHRKGVQLQESERYVMRARGTTLT 265

  Fly    80 IKDSRFSLRYDPNSSTYKLQIKDIQETDAGTYTCQVVISTVHKVSAEVKLSVRRPPVISDNSTQS 144
                                :::||:.|.|:|||: ..:...:|..|:.|.|...|.|:  ..::
Zfish   266 --------------------VRNIQQDDGGSYTCR-ASNKAGEVEHELFLKVFVQPHIT--KLRN 307

  Fly   145 VVASEGSEVQMECYASGYPTPTITWRRENNAILPTDS-----------ATYVGNTLRIKSVKKED 198
            |.|.|||...:.|.|.|.|.|.|:|||.::....:|.           ..|..:.|.|..||..|
Zfish   308 VTAVEGSAAMISCKAEGEPLPEISWRRASDGHSFSDGDKSPDGRVEVRGRYGESMLTIVVVKLSD 372

  Fly   199 RGTYYCVADNGVSKGDRRNINVEVEFAPVITVPRPRLGQALQYDMDLECHIEAYPPPAIVWTKDD 263
            .|.:.|.|.:.:. |.::::.:::|:||................:::.|.:.:.||..::|.::.
Zfish   373 WGRFDCEALSRIG-GHQKSMFLDIEYAPKFQANHTIFFSWEGNPVNISCDVMSNPPATMLWRREK 436

  Fly   264 IQL----ANNQHYSISHFATADEYT---DSTLRVITVEKRQYGDYVCKATNRFGEAEARVNLFET 321
            :.:    |.|...          ||   .|.|.|..:..|.:|.|.|.|.|..|.......|.:.
Zfish   437 LTIPSEGAGNMRV----------YTAPGRSLLEVTPMSDRDFGRYNCTARNNIGMRFQEFILAQA 491

  Fly   322 IIPVCPPACGQAYIAGAEDVSATSF 346
            .:|..|.:...:.:  |:.|:..:|
Zfish   492 DVPSNPYSVRLSSV--AQRVATVTF 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LacNP_523713.2 IG_like 36..131 CDD:214653 23/103 (22%)
FR1 37..50 CDD:409353 4/15 (27%)
Ig strand A' 37..42 CDD:409353 0/7 (0%)
Ig strand B 44..51 CDD:409353 2/6 (33%)
CDR1 51..59 CDD:409353 1/7 (14%)
Ig strand C 59..63 CDD:409353 1/9 (11%)
FR2 60..63 CDD:409353 1/8 (13%)
CDR2 67..81 CDD:409353 4/13 (31%)
Ig strand C' 68..72 CDD:409353 1/3 (33%)
Ig strand C' 79..81 CDD:409353 0/1 (0%)
FR3 84..115 CDD:409353 7/30 (23%)
Ig strand D 84..90 CDD:409353 0/5 (0%)
Ig strand E 94..102 CDD:409353 0/7 (0%)
Ig strand F 108..115 CDD:409353 4/6 (67%)
CDR3 116..124 CDD:409353 0/7 (0%)
FR4 124..130 CDD:409353 1/5 (20%)
Ig strand G 124..130 CDD:409353 1/5 (20%)
Ig_3 134..208 CDD:404760 26/84 (31%)
Ig strand B 153..157 CDD:409353 0/3 (0%)
Ig strand C 166..170 CDD:409353 1/3 (33%)
Ig strand E 187..191 CDD:409353 1/3 (33%)
Ig strand F 201..206 CDD:409353 1/4 (25%)
Ig strand G 215..218 CDD:409353 0/2 (0%)
Ig 227..318 CDD:416386 18/97 (19%)
Ig strand C 256..260 CDD:409353 0/3 (0%)
Ig strand E 286..290 CDD:409353 2/3 (67%)
Ig strand F 300..305 CDD:409353 2/4 (50%)
ncam2NP_571905.1 Ig1_NCAM-2 20..111 CDD:143274
I-set 21..110 CDD:254352
IGc2 127..187 CDD:197706
Ig 213..299 CDD:299845 24/106 (23%)
I-set 213..296 CDD:254352 23/103 (22%)
Ig 298..395 CDD:299845 27/99 (27%)
I-set 300..393 CDD:254352 27/95 (28%)
IG_like 411..488 CDD:214653 18/86 (21%)
IGc2 412..480 CDD:197706 17/77 (22%)
FN3 494..586 CDD:238020 4/22 (18%)
fn3 <616..675 CDD:278470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12231
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.