DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lac and CEACAM8

DIOPT Version :9

Sequence 1:NP_523713.2 Gene:Lac / 36363 FlyBaseID:FBgn0010238 Length:359 Species:Drosophila melanogaster
Sequence 2:XP_011524642.1 Gene:CEACAM8 / 1088 HGNCID:1820 Length:415 Species:Homo sapiens


Alignment Length:341 Identity:80/341 - (23%)
Similarity:124/341 - (36%) Gaps:83/341 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 WRPSISNCVWSTLLL--AIFVQQTLAQRTPTISYITQEQIKDIGGTVEFDCSVQYAKEYNVLFLK 64
            ||     ..|..|||  ::|.    ....||.:.:|.|.:..         :....||..:|...
Human    11 WR-----IPWQGLLLTASLFT----FWNPPTTAQLTIEAVPS---------NAAEGKEVLLLVHN 57

  Fly    65 TDSDPVFLS--TGSTL---------VIKDSR------FSLRYD--PNSSTYKLQIKDIQETDAGT 110
            ...||...:  .|.|:         ||.:.:      :|.|..  ||:|   |.::::...|.|:
Human    58 LPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNAS---LLMRNVTRNDTGS 119

  Fly   111 YTCQVVISTVHKVSAEV--KLSVR----RPPVISDNSTQSVVASEGSEVQMECYASGYPTPTITW 169
            ||.||:  .::.:|.||  :.||.    :|.:.|:||..   ..:...|...|......|..:.|
Human   120 YTLQVI--KLNLMSEEVTGQFSVHPETPKPSISSNNSNP---VEDKDAVAFTCEPETQNTTYLWW 179

  Fly   170 RRENNAILPTDSATYVGN---TLRIKSVKKEDRGTYYCVADNGVSKGDRRNINVEVEFAPVITVP 231
              .|...||......:.|   ||.:.||.:.|.|.|.|...|..|......:.:.|.:.|    .
Human   180 --VNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGP----D 238

  Fly   232 RPRLGQALQY-----DMDLECHIEAYPPPAIVWTKDDIQLANNQHYSISHFATADEYTDSTLRVI 291
            .|.:..:..|     :::|.||..:.||               ..||.|...|..:||.. |.:.
Human   239 APTISPSDTYYHAGVNLNLSCHAASNPP---------------SQYSWSVNGTFQQYTQK-LFIP 287

  Fly   292 TVEKRQYGDYVCKATN 307
            .:..:..|.|.|..||
Human   288 NITTKNSGSYACHTTN 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LacNP_523713.2 IG_like 36..131 CDD:214653 25/115 (22%)
FR1 37..50 CDD:409353 1/12 (8%)
Ig strand A' 37..42 CDD:409353 1/4 (25%)
Ig strand B 44..51 CDD:409353 0/6 (0%)
CDR1 51..59 CDD:409353 2/7 (29%)
Ig strand C 59..63 CDD:409353 1/3 (33%)
FR2 60..63 CDD:409353 1/2 (50%)
CDR2 67..81 CDD:409353 5/24 (21%)
Ig strand C' 68..72 CDD:409353 2/3 (67%)
Ig strand C' 79..81 CDD:409353 1/1 (100%)
FR3 84..115 CDD:409353 10/38 (26%)
Ig strand D 84..90 CDD:409353 2/11 (18%)
Ig strand E 94..102 CDD:409353 2/7 (29%)
Ig strand F 108..115 CDD:409353 3/6 (50%)
CDR3 116..124 CDD:409353 0/7 (0%)
FR4 124..130 CDD:409353 3/7 (43%)
Ig strand G 124..130 CDD:409353 3/7 (43%)
Ig_3 134..208 CDD:404760 20/76 (26%)
Ig strand B 153..157 CDD:409353 1/3 (33%)
Ig strand C 166..170 CDD:409353 0/3 (0%)
Ig strand E 187..191 CDD:409353 3/6 (50%)
Ig strand F 201..206 CDD:409353 2/4 (50%)
Ig strand G 215..218 CDD:409353 0/2 (0%)
Ig 227..318 CDD:416386 19/86 (22%)
Ig strand C 256..260 CDD:409353 0/3 (0%)
Ig strand E 286..290 CDD:409353 1/3 (33%)
Ig strand F 300..305 CDD:409353 2/4 (50%)
CEACAM8XP_011524642.1 Ig_CEACAM_D1 36..140 CDD:143251 26/117 (22%)
Ig 146..234 CDD:299845 22/92 (24%)
IG_like 157..233 CDD:214653 18/77 (23%)
Ig_2 240..318 CDD:290606 19/80 (24%)
IG_like 244..312 CDD:214653 18/76 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.