DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lac and CHL1

DIOPT Version :9

Sequence 1:NP_523713.2 Gene:Lac / 36363 FlyBaseID:FBgn0010238 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_006605.2 Gene:CHL1 / 10752 HGNCID:1939 Length:1224 Species:Homo sapiens


Alignment Length:229 Identity:57/229 - (24%)
Similarity:92/229 - (40%) Gaps:22/229 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 LQIKDIQETDAGTYTCQVVISTVHKVSAEVKLSVRRPPVISDNSTQSVVASEGSEVQMECYASGY 162
            |:|:::...|.|.|.| ...:.:...:.:..:.|..||..: ...||.|.|.||...:.|.|.|.
Human   311 LKIENVSYQDKGNYRC-TASNFLGTATHDFHVIVE
EPPRWT-KKPQSAVYSTGSNGILLCEAEGE 373

  Fly   163 PTPTITWRRENNAILPTDSATYVGNT-----LRIKSVKKEDRGTYYCVADNGVSKGDRRNINVE- 221
            |.|||.||...:   |.|:..:.|:.     :...:::......|.|.|.| |......|.|:: 
Human   374 PQPTIKWRVNGS---PVDNHPFAGDVVFPREISFTNLQPNHTAVYQCEASN-VHGTILANANIDV 434

  Fly   222 VEFAPVI-TVPRPRLGQALQYDMDLECHIEAYPPPAIVWTK-DDIQLANNQHYSISHFATADEYT 284
            |:..|:| |.........:.|...|.|...|.|...:.|.| ::::....:.|.|        |.
Human   435 VDVRPLIQTKDGENYATVVGYSAFLHCEFFASPEAVVSWQKVEEVKPLEGRRYHI--------YE 491

  Fly   285 DSTLRVITVEKRQYGDYVCKATNRFGEAEARVNL 318
            :.||::....:...|.|.|...|..|:.....||
Human   492 NGTLQINRTTEEDAGSYSCWVENAIGKTAVTANL 525

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LacNP_523713.2 IG_like 36..131 CDD:214653 6/32 (19%)
FR1 37..50 CDD:409353
Ig strand A' 37..42 CDD:409353
Ig strand B 44..51 CDD:409353
CDR1 51..59 CDD:409353
Ig strand C 59..63 CDD:409353
FR2 60..63 CDD:409353
CDR2 67..81 CDD:409353
Ig strand C' 68..72 CDD:409353
Ig strand C' 79..81 CDD:409353
FR3 84..115 CDD:409353 6/16 (38%)
Ig strand D 84..90 CDD:409353
Ig strand E 94..102 CDD:409353 2/3 (67%)
Ig strand F 108..115 CDD:409353 3/6 (50%)
CDR3 116..124 CDD:409353 0/7 (0%)
FR4 124..130 CDD:409353 0/5 (0%)
Ig strand G 124..130 CDD:409353 0/5 (0%)
Ig_3 134..208 CDD:404760 23/78 (29%)
Ig strand B 153..157 CDD:409353 0/3 (0%)
Ig strand C 166..170 CDD:409353 2/3 (67%)
Ig strand E 187..191 CDD:409353 0/8 (0%)
Ig strand F 201..206 CDD:409353 2/4 (50%)
Ig strand G 215..218 CDD:409353 0/2 (0%)
Ig 227..318 CDD:416386 19/92 (21%)
Ig strand C 256..260 CDD:409353 0/3 (0%)
Ig strand E 286..290 CDD:409353 2/3 (67%)
Ig strand F 300..305 CDD:409353 2/4 (50%)
CHL1NP_006605.2 Ig 55..126 CDD:299845
Ig2_L1-CAM_like 129..223 CDD:143253
IG_like 140..224 CDD:214653
IG_like 264..343 CDD:214653 6/32 (19%)
Ig3_L1-CAM_like 274..344 CDD:143208 6/33 (18%)
IG_like 353..434 CDD:214653 25/84 (30%)
Ig4_L1-NrCAM_like 361..435 CDD:143179 21/77 (27%)
IG_like 447..525 CDD:214653 17/85 (20%)
Ig 457..525 CDD:299845 16/75 (21%)
IG_like 548..624 CDD:214653
Ig 548..616 CDD:143165
DGEA 571..574
FN3 628..717 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 709..732
fn3 731..811 CDD:278470
FN3 834..927 CDD:238020
FN3 932..1027 CDD:238020
Bravo_FIGEY 1120..1205 CDD:290593
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1147..1179
FIG[AQ]Y 1197..1201
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1205..1224
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 61 1.000 Domainoid score I10455
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12231
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.