DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lac and LOC105945166

DIOPT Version :9

Sequence 1:NP_523713.2 Gene:Lac / 36363 FlyBaseID:FBgn0010238 Length:359 Species:Drosophila melanogaster
Sequence 2:XP_017945093.1 Gene:LOC105945166 / 105945166 -ID:- Length:404 Species:Xenopus tropicalis


Alignment Length:332 Identity:65/332 - (19%)
Similarity:100/332 - (30%) Gaps:144/332 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 YKLQIKDIQETDAGTYTCQVVISTVH-------------------------KVSAEVKLSVRR-- 133
            :.|.|:::...|:|.|.|.|..|..|                         ::..:|.::..|  
 Frog   104 FPLMIRNLTAQDSGKYYCYVESSDHHSMATVDFIVTVPCHPKTHSHKESGVRIPRDVSINQERQS 168

  Fly   134 ---------------PPVISDNSTQSVVASEGSEVQMECYASG-YPTPTITWR-RENNAILPTDS 181
                           |||||..:..:|.          |.:.| ||.|.:.|. .|.|.::|:  
 Frog   169 QAQRSDSPKEGAVGSPPVISTIADDTVF----------CESDGWYPEPYLIWTDNEGNKVMPS-- 221

  Fly   182 ATYVGNTLRIKSVKKEDRGTYY---------------CVADNGV--SKGDRRNINVEVEFAPVIT 229
                     ::.|.|:::..|.               |...:.:  ||...|.|.. |...|||:
 Frog   222 ---------MEKVFKDEKSLYQVISAIYLPPTSSNITCTVSSSLNQSKESSRQIRA-VGSPPVIS 276

  Fly   230 VPRPRLGQALQYDMDLECHIEA-YPPPAIVWTKDDIQLANN----------------QHYSISHF 277
                    .:..| .:.|..:. ||.|.:|||.|:   .||                |..|..:.
 Frog   277 --------TITED-TVFCESDGWYPEPYLVWTDDE---GNNIIPSMEKVSKDKKSLYQVISAIYL 329

  Fly   278 ATADEYTDSTLRVI----------TVEKR------QYG----------------DYVCKATNRFG 310
            ..|......|:...          |:|.|      ||.                .|:|....|.|
 Frog   330 PPASSNITCTVSSSLNQSKQSSRQTIEMRPVTCRDQYSRYIVFCACLVVILMLLGYICFLLKRLG 394

  Fly   311 EAEARVN 317
            |.:..||
 Frog   395 ELQRNVN 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LacNP_523713.2 IG_like 36..131 CDD:214653 10/59 (17%)
FR1 37..50 CDD:409353
Ig strand A' 37..42 CDD:409353
Ig strand B 44..51 CDD:409353
CDR1 51..59 CDD:409353
Ig strand C 59..63 CDD:409353
FR2 60..63 CDD:409353
CDR2 67..81 CDD:409353
Ig strand C' 68..72 CDD:409353
Ig strand C' 79..81 CDD:409353
FR3 84..115 CDD:409353 6/18 (33%)
Ig strand D 84..90 CDD:409353
Ig strand E 94..102 CDD:409353 2/5 (40%)
Ig strand F 108..115 CDD:409353 3/6 (50%)
CDR3 116..124 CDD:409353 2/32 (6%)
FR4 124..130 CDD:409353 1/5 (20%)
Ig strand G 124..130 CDD:409353 1/5 (20%)
Ig_3 134..208 CDD:404760 19/90 (21%)
Ig strand B 153..157 CDD:409353 0/3 (0%)
Ig strand C 166..170 CDD:409353 0/3 (0%)
Ig strand E 187..191 CDD:409353 0/3 (0%)
Ig strand F 201..206 CDD:409353 2/19 (11%)
Ig strand G 215..218 CDD:409353 1/2 (50%)
Ig 227..318 CDD:416386 29/140 (21%)
Ig strand C 256..260 CDD:409353 1/3 (33%)
Ig strand E 286..290 CDD:409353 1/3 (33%)
Ig strand F 300..305 CDD:409353 2/4 (50%)
LOC105945166XP_017945093.1 Ig 32..139 CDD:416386 9/34 (26%)
Ig strand A' 34..38 CDD:409353
Ig strand B 41..49 CDD:409353
CDR1 50..58 CDD:409353
Ig strand C 58..63 CDD:409353
FR2 59..63 CDD:409353
CDR2 64..82 CDD:409353
Ig strand C' 68..76 CDD:409353
Ig strand C' 77..80 CDD:409353
FR3 84..124 CDD:409353 6/19 (32%)
Ig strand D 91..96 CDD:409353
Ig strand E 102..110 CDD:409353 2/5 (40%)
Ig strand F 117..125 CDD:409353 4/7 (57%)
CDR3 125..127 CDD:409353 0/1 (0%)
Ig strand G 127..139 CDD:409353 1/11 (9%)
FR4 128..139 CDD:409353 1/10 (10%)
Ig <197..256 CDD:416386 13/69 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.