| Sequence 1: | NP_523713.2 | Gene: | Lac / 36363 | FlyBaseID: | FBgn0010238 | Length: | 359 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_006505020.1 | Gene: | Hepacam2 / 101202 | MGIID: | 2141520 | Length: | 464 | Species: | Mus musculus |
| Alignment Length: | 276 | Identity: | 74/276 - (26%) |
|---|---|---|---|
| Similarity: | 113/276 - (40%) | Gaps: | 54/276 - (19%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 61 LFLKTDSDPVFLSTGST--LVIKDSRFSLRY---DPNSSTYKLQIKDIQETDAGTYTCQVVISTV 120
Fly 121 HKVSAEVKLSVR-----RPPVISDNSTQSVVASEGSEVQMECYASGYPTPTITWRRENNAILPTD 180
Fly 181 SATY--VGNTLRIKSVKKEDRGTYYCVADNGVSKGDRRNINVEVEFAP---------------VI 228
Fly 229 TVPRPRLGQALQYDMDLECHIEAYPPPAIVWTKDDIQLANNQHYSISHFATADEYTDSTLRVITV 293
Fly 294 EK--RQYGDYVCKATN 307 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Lac | NP_523713.2 | IG_like | 36..131 | CDD:214653 | 23/74 (31%) |
| FR1 | 37..50 | CDD:409353 | |||
| Ig strand A' | 37..42 | CDD:409353 | |||
| Ig strand B | 44..51 | CDD:409353 | |||
| CDR1 | 51..59 | CDD:409353 | |||
| Ig strand C | 59..63 | CDD:409353 | 1/1 (100%) | ||
| FR2 | 60..63 | CDD:409353 | 1/1 (100%) | ||
| CDR2 | 67..81 | CDD:409353 | 5/15 (33%) | ||
| Ig strand C' | 68..72 | CDD:409353 | 1/3 (33%) | ||
| Ig strand C' | 79..81 | CDD:409353 | 1/1 (100%) | ||
| FR3 | 84..115 | CDD:409353 | 10/33 (30%) | ||
| Ig strand D | 84..90 | CDD:409353 | 0/8 (0%) | ||
| Ig strand E | 94..102 | CDD:409353 | 3/7 (43%) | ||
| Ig strand F | 108..115 | CDD:409353 | 2/6 (33%) | ||
| CDR3 | 116..124 | CDD:409353 | 1/7 (14%) | ||
| FR4 | 124..130 | CDD:409353 | 3/5 (60%) | ||
| Ig strand G | 124..130 | CDD:409353 | 3/5 (60%) | ||
| Ig_3 | 134..208 | CDD:404760 | 20/75 (27%) | ||
| Ig strand B | 153..157 | CDD:409353 | 0/3 (0%) | ||
| Ig strand C | 166..170 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 187..191 | CDD:409353 | 3/3 (100%) | ||
| Ig strand F | 201..206 | CDD:409353 | 2/4 (50%) | ||
| Ig strand G | 215..218 | CDD:409353 | 0/2 (0%) | ||
| Ig | 227..318 | CDD:416386 | 25/83 (30%) | ||
| Ig strand C | 256..260 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 286..290 | CDD:409353 | 0/3 (0%) | ||
| Ig strand F | 300..305 | CDD:409353 | 4/4 (100%) | ||
| Hepacam2 | XP_006505020.1 | Ig | 37..144 | CDD:386229 | 24/76 (32%) |
| Ig | 168..234 | CDD:319273 | 20/65 (31%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||