| Sequence 1: | NP_523713.2 | Gene: | Lac / 36363 | FlyBaseID: | FBgn0010238 | Length: | 359 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_031748713.1 | Gene: | LOC100496188 / 100496188 | -ID: | - | Length: | 852 | Species: | Xenopus tropicalis |
| Alignment Length: | 316 | Identity: | 71/316 - (22%) |
|---|---|---|---|
| Similarity: | 117/316 - (37%) | Gaps: | 73/316 - (23%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 87 LRYD-------PNSS---------TYKLQIKDIQETDAGTYTCQVVIS--TVHKVSAEVKLSVRR 133
Fly 134 -PPVISDNSTQSVVASEGSEVQMECYASG-YPTP-TITWRRENNAILP----------TDSATYV 185
Fly 186 GNTLRIKSVKKEDRGTYYCVADNGVSKGDRR-NINVEVEFAPVITVPRPRL-GQALQYDMDLECH 248
Fly 249 IEAYPPP--AIVW-----TKDDIQLANNQHYSISHFATADEYTDSTLRVITVEKRQYGDYVCKAT 306
Fly 307 NRFGEAEARVNLFETIIPVCPPACGQAYIAGAEDVSATSFALV-----GILAALLF 357 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Lac | NP_523713.2 | IG_like | 36..131 | CDD:214653 | 18/61 (30%) |
| FR1 | 37..50 | CDD:409353 | |||
| Ig strand A' | 37..42 | CDD:409353 | |||
| Ig strand B | 44..51 | CDD:409353 | |||
| CDR1 | 51..59 | CDD:409353 | |||
| Ig strand C | 59..63 | CDD:409353 | |||
| FR2 | 60..63 | CDD:409353 | |||
| CDR2 | 67..81 | CDD:409353 | |||
| Ig strand C' | 68..72 | CDD:409353 | |||
| Ig strand C' | 79..81 | CDD:409353 | |||
| FR3 | 84..115 | CDD:409353 | 12/43 (28%) | ||
| Ig strand D | 84..90 | CDD:409353 | 2/2 (100%) | ||
| Ig strand E | 94..102 | CDD:409353 | 2/16 (13%) | ||
| Ig strand F | 108..115 | CDD:409353 | 4/6 (67%) | ||
| CDR3 | 116..124 | CDD:409353 | 3/9 (33%) | ||
| FR4 | 124..130 | CDD:409353 | 1/5 (20%) | ||
| Ig strand G | 124..130 | CDD:409353 | 1/5 (20%) | ||
| Ig_3 | 134..208 | CDD:404760 | 20/85 (24%) | ||
| Ig strand B | 153..157 | CDD:409353 | 0/3 (0%) | ||
| Ig strand C | 166..170 | CDD:409353 | 2/3 (67%) | ||
| Ig strand E | 187..191 | CDD:409353 | 2/3 (67%) | ||
| Ig strand F | 201..206 | CDD:409353 | 1/4 (25%) | ||
| Ig strand G | 215..218 | CDD:409353 | 2/3 (67%) | ||
| Ig | 227..318 | CDD:416386 | 18/98 (18%) | ||
| Ig strand C | 256..260 | CDD:409353 | 2/8 (25%) | ||
| Ig strand E | 286..290 | CDD:409353 | 0/3 (0%) | ||
| Ig strand F | 300..305 | CDD:409353 | 1/4 (25%) | ||
| LOC100496188 | XP_031748713.1 | V-set | 30..133 | CDD:400157 | 18/62 (29%) |
| Ig strand B | 41..48 | CDD:409353 | |||
| CDR1 | 49..58 | CDD:409353 | |||
| FR2 | 60..70 | CDD:409353 | |||
| Ig strand C | 60..67 | CDD:409353 | |||
| Ig strand C' | 76..79 | CDD:409353 | 1/2 (50%) | ||
| FR3 | 82..117 | CDD:409353 | 8/34 (24%) | ||
| Ig strand D | 85..91 | CDD:409353 | 1/5 (20%) | ||
| Ig strand E | 97..103 | CDD:409353 | 1/5 (20%) | ||
| Ig strand A | 136..143 | CDD:409353 | 2/8 (25%) | ||
| Ig strand B | 150..160 | CDD:409353 | 2/11 (18%) | ||
| C1-set | 153..220 | CDD:400140 | 16/67 (24%) | ||
| Ig strand C | 165..171 | CDD:409353 | 3/5 (60%) | ||
| Ig strand C' | 173..176 | CDD:409353 | 0/2 (0%) | ||
| Ig strand D | 180..187 | CDD:409353 | 0/6 (0%) | ||
| Ig strand E | 190..200 | CDD:409353 | 2/9 (22%) | ||
| Ig strand F | 210..217 | CDD:409353 | 1/6 (17%) | ||
| Ig | 234..315 | CDD:416386 | 19/98 (19%) | ||
| Ig strand A | 235..242 | CDD:409353 | 2/6 (33%) | ||
| Ig strand B | 251..258 | CDD:409353 | 3/9 (33%) | ||
| Ig strand C | 264..270 | CDD:409353 | 1/5 (20%) | ||
| Ig strand C' | 273..275 | CDD:409353 | 0/1 (0%) | ||
| Ig strand E | 287..295 | CDD:409353 | 3/7 (43%) | ||
| Ig strand F | 302..312 | CDD:409353 | 3/14 (21%) | ||
| IgC1 | <617..702 | CDD:409354 | |||
| Ig strand C | 628..632 | CDD:409354 | |||
| Ig strand E | 669..673 | CDD:409354 | |||
| Ig strand F | 684..689 | CDD:409354 | |||
| Ig strand G | 699..702 | CDD:409354 | |||
| Ig | 701..804 | CDD:416386 | |||
| Ig strand B | 712..729 | CDD:409353 | |||
| Ig strand C | 734..741 | CDD:409353 | |||
| Ig strand C' | 750..753 | CDD:409353 | |||
| Ig strand E | 766..781 | CDD:409353 | |||
| Ig strand F | 789..795 | CDD:409353 | |||
| Ig strand G | 798..804 | CDD:409353 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||