DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lac and iglon5

DIOPT Version :9

Sequence 1:NP_523713.2 Gene:Lac / 36363 FlyBaseID:FBgn0010238 Length:359 Species:Drosophila melanogaster
Sequence 2:XP_002938252.1 Gene:iglon5 / 100488314 XenbaseID:XB-GENE-945713 Length:333 Species:Xenopus tropicalis


Alignment Length:375 Identity:102/375 - (27%)
Similarity:152/375 - (40%) Gaps:76/375 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RPSISNCVWSTLLLAIFVQQTLAQRTPTISYITQEQIKDIGGTVEFDC-------SVQYAKEYNV 60
            |.|:::.....|...:|||.|  :..|.....|..|    |......|       .|.:....|:
 Frog     7 RVSLASLGIVMLAQVLFVQCT--EFVPPADNYTVSQ----GDNATLSCLIDDKVTRVAWLNRSNI 65

  Fly    61 LFLKTDSDPVFLSTGSTLVIKDSRFSLRYDPNSSTYKLQIKDIQETDAGTYTCQVVISTVHKV-S 124
            |:...|...:           |||..|..: ..|.|.:.|..:...|.|.|||.  ..|..|. :
 Frog    66 LYAGKDKWSI-----------DSRVQLLTN-TKSEYSIVITHVDVADEGLYTCS--FQTEDKPHT 116

  Fly   125 AEVKLSVRRPPVISDNSTQSVVASEGSEVQMECYASGYPTPTITWRRENNAILPTDSATYVGNTL 189
            ::|.|.|:.|..|. |.:.||..:|||.|.::|.|.|.|.|||||::      .::..:..|..|
 Frog   117 SQVYLIVQVPAKIV-NISSSVTVNEGSNVNLQCLAVGKPEPTITWQQ------LSEGFSSEGELL 174

  Fly   190 RIKSVKKEDRGTYYCVADNGVSKGDRRNINVEVEFAPVIT--------VPRPRLGQALQYDMDLE 246
            .|..:.::..|.|.||..||||..|.:.:.:.|.:.|.||        |.||         ..|.
 Frog   175 EITEINRQQAGDYECVTSNGVSVPDTKKVQITVNYPPYITDVKNAQSPVGRP---------ATLR 230

  Fly   247 CHIEAYPPPAIVWTKDDIQ--LANNQHYSISHFATADEYTDSTLRVI---TVEKRQYGDYVCKAT 306
            |...|.||....|.||:.:  ::..:..||.        |:|:..||   .|..|.||:|.|.|:
 Frog   231 CKAMAVPPAEFEWYKDEKRRLISGTEGLSIK--------TESSWSVIVFSNVTSRHYGNYTCLAS 287

  Fly   307 NRFGEAEARVNLFETIIPVCPPACGQAYIAGAEDVSATSFALVGILAALL 356
            |:.|...:.:.|.:.         |.....||..:  .|..|:|:|::.|
 Frog   288 NKLGSFNSSLRLLKP---------GDPLNQGATHM--VSPLLLGLLSSTL 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LacNP_523713.2 IG_like 36..131 CDD:214653 23/102 (23%)
FR1 37..50 CDD:409353 2/12 (17%)
Ig strand A' 37..42 CDD:409353 1/4 (25%)
Ig strand B 44..51 CDD:409353 1/13 (8%)
CDR1 51..59 CDD:409353 1/7 (14%)
Ig strand C 59..63 CDD:409353 2/3 (67%)
FR2 60..63 CDD:409353 1/2 (50%)
CDR2 67..81 CDD:409353 0/13 (0%)
Ig strand C' 68..72 CDD:409353 0/3 (0%)
Ig strand C' 79..81 CDD:409353 0/1 (0%)
FR3 84..115 CDD:409353 10/30 (33%)
Ig strand D 84..90 CDD:409353 2/5 (40%)
Ig strand E 94..102 CDD:409353 3/7 (43%)
Ig strand F 108..115 CDD:409353 4/6 (67%)
CDR3 116..124 CDD:409353 2/8 (25%)
FR4 124..130 CDD:409353 1/5 (20%)
Ig strand G 124..130 CDD:409353 1/5 (20%)
Ig_3 134..208 CDD:404760 25/73 (34%)
Ig strand B 153..157 CDD:409353 1/3 (33%)
Ig strand C 166..170 CDD:409353 3/3 (100%)
Ig strand E 187..191 CDD:409353 1/3 (33%)
Ig strand F 201..206 CDD:409353 2/4 (50%)
Ig strand G 215..218 CDD:409353 0/2 (0%)
Ig 227..318 CDD:416386 28/103 (27%)
Ig strand C 256..260 CDD:409353 0/3 (0%)
Ig strand E 286..290 CDD:409353 1/3 (33%)
Ig strand F 300..305 CDD:409353 2/4 (50%)
iglon5XP_002938252.1 Ig 31..123 CDD:299845 25/109 (23%)
IG_like 35..123 CDD:214653 24/105 (23%)
Ig 126..207 CDD:299845 30/87 (34%)
I-set 128..207 CDD:254352 29/85 (34%)
I-set 210..299 CDD:254352 29/105 (28%)
Ig 227..298 CDD:143165 23/78 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.