| Sequence 1: | NP_523713.2 | Gene: | Lac / 36363 | FlyBaseID: | FBgn0010238 | Length: | 359 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_031761656.1 | Gene: | igsf9b / 100379858 | XenbaseID: | XB-GENE-5887265 | Length: | 1392 | Species: | Xenopus tropicalis |
| Alignment Length: | 365 | Identity: | 90/365 - (24%) |
|---|---|---|---|
| Similarity: | 144/365 - (39%) | Gaps: | 66/365 - (18%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 10 VWSTLLLAIFVQQTL---------AQRTPTISYITQEQIKDIGGTVEFDCSVQY-----AKEYNV 60
Fly 61 LFLKTDSD-PVFLSTGSTLVIKDSRFSLR---YDPNSSTYKLQIKDIQETDAGTYTCQVVI---- 117
Fly 118 -STVHKVSAEVKLSVRRPPVISDNSTQSVVASEGSEVQMECYASGYPTPTITWRRENNAILPTDS 181
Fly 182 ATYVGNTLRIKSVKKEDRGTYYCVADNGVSKGDR-RNINVEVEFAPVITVPRPRLGQALQYDMDL 245
Fly 246 ECHIEAYPPPAI---VWTKDDIQLANNQHYSISHFATADEYTDSTLRVITVEKRQYGDYVCKATN 307
Fly 308 RFGEAEAR------------VNLFETI-IPV-------CP 327 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Lac | NP_523713.2 | IG_like | 36..131 | CDD:214653 | 26/108 (24%) |
| FR1 | 37..50 | CDD:409353 | 2/12 (17%) | ||
| Ig strand A' | 37..42 | CDD:409353 | 0/4 (0%) | ||
| Ig strand B | 44..51 | CDD:409353 | 1/6 (17%) | ||
| CDR1 | 51..59 | CDD:409353 | 1/12 (8%) | ||
| Ig strand C | 59..63 | CDD:409353 | 1/3 (33%) | ||
| FR2 | 60..63 | CDD:409353 | 1/2 (50%) | ||
| CDR2 | 67..81 | CDD:409353 | 3/14 (21%) | ||
| Ig strand C' | 68..72 | CDD:409353 | 1/4 (25%) | ||
| Ig strand C' | 79..81 | CDD:409353 | 0/1 (0%) | ||
| FR3 | 84..115 | CDD:409353 | 10/33 (30%) | ||
| Ig strand D | 84..90 | CDD:409353 | 1/8 (13%) | ||
| Ig strand E | 94..102 | CDD:409353 | 2/7 (29%) | ||
| Ig strand F | 108..115 | CDD:409353 | 3/6 (50%) | ||
| CDR3 | 116..124 | CDD:409353 | 2/12 (17%) | ||
| FR4 | 124..130 | CDD:409353 | 1/5 (20%) | ||
| Ig strand G | 124..130 | CDD:409353 | 1/5 (20%) | ||
| Ig_3 | 134..208 | CDD:404760 | 26/73 (36%) | ||
| Ig strand B | 153..157 | CDD:409353 | 0/3 (0%) | ||
| Ig strand C | 166..170 | CDD:409353 | 1/3 (33%) | ||
| Ig strand E | 187..191 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 201..206 | CDD:409353 | 2/4 (50%) | ||
| Ig strand G | 215..218 | CDD:409353 | 0/3 (0%) | ||
| Ig | 227..318 | CDD:416386 | 20/105 (19%) | ||
| Ig strand C | 256..260 | CDD:409353 | 0/6 (0%) | ||
| Ig strand E | 286..290 | CDD:409353 | 2/3 (67%) | ||
| Ig strand F | 300..305 | CDD:409353 | 2/4 (50%) | ||
| igsf9b | XP_031761656.1 | IG | 30..115 | CDD:214652 | 23/94 (24%) |
| I-set | 139..225 | CDD:400151 | 26/87 (30%) | ||
| Ig strand A | 139..142 | CDD:409353 | 1/2 (50%) | ||
| Ig strand A' | 148..151 | CDD:409353 | 0/2 (0%) | ||
| Ig strand B | 157..164 | CDD:409353 | 1/6 (17%) | ||
| Ig strand C | 170..175 | CDD:409353 | 2/4 (50%) | ||
| Ig strand D | 185..189 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 191..195 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 204..212 | CDD:409353 | 4/7 (57%) | ||
| Ig strand G | 215..225 | CDD:409353 | 1/9 (11%) | ||
| I-set | 229..321 | CDD:400151 | 20/97 (21%) | ||
| Ig strand B | 246..250 | CDD:409353 | 0/3 (0%) | ||
| Ig strand C | 260..264 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 286..290 | CDD:409353 | 2/3 (67%) | ||
| Ig strand F | 300..305 | CDD:409353 | 2/4 (50%) | ||
| Ig strand G | 314..317 | CDD:409353 | 0/2 (0%) | ||
| Ig | 344..405 | CDD:409353 | 2/4 (50%) | ||
| Ig strand C | 355..360 | CDD:409353 | |||
| Ig strand E | 380..384 | CDD:409353 | |||
| Ig strand F | 394..399 | CDD:409353 | |||
| Ig | 429..505 | CDD:416386 | |||
| Ig strand A' | 429..432 | CDD:409353 | |||
| Ig strand B | 438..445 | CDD:409353 | |||
| Ig strand C | 451..456 | CDD:409353 | |||
| Ig strand C' | 458..460 | CDD:409353 | |||
| Ig strand E | 471..476 | CDD:409353 | |||
| Ig strand F | 484..492 | CDD:409353 | |||
| Ig strand G | 495..505 | CDD:409353 | |||
| FN3 | 510..605 | CDD:238020 | |||
| FN3 | 622..703 | CDD:238020 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||