DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Lac and nrcam

DIOPT Version :9

Sequence 1:	NP_523713.2	Gene:	Lac / 36363	FlyBaseID:	FBgn0010238	Length:	359	Species:	Drosophila melanogaster
Sequence 2:	XP_031753581.1	Gene:	nrcam / 100216214	XenbaseID:	XB-GENE-489769	Length:	1325	Species:	Xenopus tropicalis

Alignment Length:	241	Identity:	70/241 - (29%)
Similarity:	101/241 - (41%)	Gaps:	46/241 - (19%)

- Green bases have known domain annotations that are detailed below.

  Fly    98 LQIKDIQETDAGTYTC---QVVISTVHKVSAEVKLSVR--RPPVISDNSTQSVVASEGSEVQMEC 157
            |:|.|:.|.|||.|.|   .::.:|.|.::..||.:..  .||       :::|.|.|.:..:.|
Frog   332 LKIIDVTEADAGKYKCIGRNILGTTHHIITVTVKAAPYWITPP-------RNIVLSPGEDGSLTC 389

  Fly   158 YASGYPTPTITWRRENNAI--LPTDSATYV-GNTLRIKSVKKEDRGTYYCVADNGVSKGDRRNIN 219
            .|||.|||:|||.....:|  .|||::..| |:|:....|:......|.|.|.|      :....
Frog   390 RASGSPTPSITWLINGVSIELAPTDASRRVDGDTIMFSKVQDGATAVYQCNASN------KYGYL 448

  Fly   220 VEVEFAPVITVPRPRL------------GQALQYDMDLECHIEAYPPPAIVWTKDDIQLANNQHY 272
            :...|..||..| ||:            ..||     |.|.....|.|.|.|.|       ..|.
Frog   449 LANAFVNVIAEP-PRIMMSKHVYKVIANNVAL-----LHCPFFGSPKPEIKWFK-------GAHG 500

  Fly   273 SISHFATADEYTDSTLRVITVEKRQYGDYVCKATNRFGEAEARVNL 318
            |:.|......:.:.||.:...:|...|:|.|.|||.||..:..:.|
Frog   501 SVLHGNGYVFHDNGTLEIPVAQKDSSGNYTCVATNSFGSVKDMIGL 546

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Lac	NP_523713.2	IG_like	36..131	CDD:214653	13/35 (37%)
		FR1	37..50	CDD:409353
		Ig strand A'	37..42	CDD:409353
		Ig strand B	44..51	CDD:409353
		CDR1	51..59	CDD:409353
		Ig strand C	59..63	CDD:409353
		FR2	60..63	CDD:409353
		CDR2	67..81	CDD:409353
		Ig strand C'	68..72	CDD:409353
		Ig strand C'	79..81	CDD:409353
		FR3	84..115	CDD:409353	9/19 (47%)
		Ig strand D	84..90	CDD:409353
		Ig strand E	94..102	CDD:409353	2/3 (67%)
		Ig strand F	108..115	CDD:409353	4/9 (44%)
		CDR3	116..124	CDD:409353	2/7 (29%)
		FR4	124..130	CDD:409353	2/5 (40%)
		Ig strand G	124..130	CDD:409353	2/5 (40%)
		Ig_3	134..208	CDD:404760	26/76 (34%)
		Ig strand B	153..157	CDD:409353	0/3 (0%)
		Ig strand C	166..170	CDD:409353	2/3 (67%)
		Ig strand E	187..191	CDD:409353	1/3 (33%)
		Ig strand F	201..206	CDD:409353	2/4 (50%)
		Ig strand G	215..218	CDD:409353	0/2 (0%)
		Ig	227..318	CDD:416386	28/102 (27%)
		Ig strand C	256..260	CDD:409353	1/3 (33%)
		Ig strand E	286..290	CDD:409353	2/3 (67%)
		Ig strand F	300..305	CDD:409353	2/4 (50%)
nrcam	XP_031753581.1	Ig	41..135	CDD:416386
		Ig strand A	41..45	CDD:409353
		Ig strand A'	50..54	CDD:409353
		Ig strand B	59..66	CDD:409353
		Ig strand C	72..77	CDD:409353
		Ig strand C'	80..82	CDD:409353
		Ig strand D	89..92	CDD:409353
		Ig strand E	97..101	CDD:409353
		Ig strand F	114..122	CDD:409353
		Ig strand G	125..135	CDD:409353
		Ig	156..246	CDD:416386
		Ig strand A	156..159	CDD:409353
		Ig strand A'	161..165	CDD:409353
		Ig strand B	168..176	CDD:409353
		Ig strand C	183..189	CDD:409353
		Ig strand C'	192..195	CDD:409353
		Ig strand D	201..205	CDD:409353
		Ig strand E	207..211	CDD:409353
		Ig strand F	222..230	CDD:409353
		Ig strand G	233..246	CDD:409353
		Ig	299..365	CDD:416386	11/32 (34%)
		Ig strand C	308..312	CDD:409353
		Ig strand E	330..334	CDD:409353	1/1 (100%)
		Ig strand F	344..349	CDD:409353	2/4 (50%)
		Ig strand G	357..360	CDD:409353	1/2 (50%)
		Ig	369..457	CDD:416386	28/100 (28%)
		Ig strand B	385..389	CDD:409353	0/3 (0%)
		Ig strand C	398..402	CDD:409353	2/3 (67%)
		Ig strand E	422..426	CDD:409353	1/3 (33%)
		Ig strand F	436..441	CDD:409353	2/4 (50%)
		Ig strand G	449..452	CDD:409353	0/2 (0%)
		Ig strand A'	469..472	CDD:409353	0/2 (0%)
		IGc2	478..538	CDD:197706	21/71 (30%)
		Ig strand B	478..485	CDD:409353	4/11 (36%)
		Ig strand C	491..496	CDD:409353	2/4 (50%)
		Ig strand C'	498..500	CDD:409353	0/1 (0%)
		Ig strand D	507..511	CDD:409353	0/3 (0%)
		Ig strand E	514..519	CDD:409353	2/4 (50%)
		Ig strand F	527..535	CDD:409353	4/7 (57%)
		Ig	554..639	CDD:416386
		Ig strand A	555..558	CDD:409353
		Ig strand A'	560..564	CDD:409353
		Ig strand B	567..576	CDD:409353
		Ig strand C	584..589	CDD:409353
		Ig strand C'	592..595	CDD:409353
		Ig strand D	599..604	CDD:409353
		Ig strand E	605..611	CDD:409353
		Ig strand F	618..626	CDD:409353
		Ig strand G	629..639	CDD:409353
		FN3	653..743	CDD:238020
		fn3	756..837	CDD:394996
		FN3	854..953	CDD:238020
		fn3	959..1043	CDD:394996
		FN3	1090..1171	CDD:238020
		Bravo_FIGEY	1212..1297	CDD:404722
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910